Growth arrest and DNA damage-inducible protein GADD45 alpha (Gadd45a) Recombinant Protein | Gadd45a recombinant protein
Recombinant Rat Growth arrest and DNA damage-inducible protein GADD45 alpha (Gadd45a)
Gene Names
Gadd45a; Ddit1; Gadd45
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth arrest and DNA damage-inducible protein GADD45 alpha (Gadd45a); Recombinant Rat Growth arrest and DNA damage-inducible protein GADD45 alpha (Gadd45a); Gadd45a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-165, Full length protein
Sequence
MTLEEFSAAEQKIERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDKSPAESGGLAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Sequence Length
165
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gadd45a recombinant protein
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. This protein responds to environmental stresses by mediating activation of the p38
JNK pathway via MTK1
MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms.
JNK pathway via MTK1
MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
18,480 Da
NCBI Official Full Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
NCBI Official Synonym Full Names
growth arrest and DNA-damage-inducible, alpha
NCBI Official Symbol
Gadd45a
NCBI Official Synonym Symbols
Ddit1; Gadd45
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
Protein Family
UniProt Gene Name
Gadd45a
UniProt Synonym Gene Names
Ddit1; Gadd45; DDIT-1
NCBI Description
may mediate a delay in G2 to M cell cycle progression; may induce DNA repair [RGD, Feb 2006]
Uniprot Description
Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity ().
Research Articles on Gadd45a
Similar Products
Product Notes
The Gadd45a gadd45a (Catalog #AAA950042) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-165, Full length protein. The amino acid sequence is listed below: MTLEEFSAAE QKIERMDTVG DALEEVLSKA RSQRTITVGV YEAAKLLNVD PDNVVLCLLA ADEDDDRDVA LQIHFTLIRA FCCENDINIL RVSNPGRLAE LLLLENDKSP AESGGLAQTP DLHCVLVTNP HSSQWKDPAL SQLICFCRES RYMDQWVPVI NLPER. It is sometimes possible for the material contained within the vial of "Growth arrest and DNA damage-inducible protein GADD45 alpha (Gadd45a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
