Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Corticotropin-releasing factor receptor 2 (Crhr2) Recombinant Protein | Crhr2 recombinant protein

Recombinant Rat Corticotropin-releasing factor receptor 2 (Crhr2)

Gene Names
Crhr2; Crf2r
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Corticotropin-releasing factor receptor 2 (Crhr2); Recombinant Rat Corticotropin-releasing factor receptor 2 (Crhr2); Recombinant Corticotropin-releasing factor receptor 2 (Crhr2); Corticotropin-releasing factor receptor 2; CRF-R-2; CRF-R2; CRFR-2; Corticotropin-releasing hormone receptor 2; CRH-R-2; CRH-R2; Crhr2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-411
Sequence
LAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRINYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGNEVWCRCVTTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIVAWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
Sequence Length
411
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,707 Da
NCBI Official Full Name
corticotropin-releasing factor receptor 2
NCBI Official Synonym Full Names
corticotropin releasing hormone receptor 2
NCBI Official Symbol
Crhr2
NCBI Official Synonym Symbols
Crf2r
NCBI Protein Information
corticotropin-releasing factor receptor 2; CRF2; CRF-R2; CRFR-2; CRH-R2; CRF-R 2; CRF-R-2; CRH-R 2; CRH-R-2; corticotropin-releasing hormone receptor 2; corticotrophin releasing hormone receptor 2; corticotropin-releasing factor receptor subtype 2
UniProt Protein Name
Corticotropin-releasing factor receptor 2
UniProt Gene Name
Crhr2
UniProt Synonym Gene Names
Crf2r; CRF-R-2; CRF-R2; CRFR-2; CRH-R-2; CRH-R2
UniProt Entry Name
CRFR2_RAT

NCBI Description

high-affinity G-protein-coupled receptor for corticotrophin releasing hormone [RGD, Feb 2006]

Uniprot Description

CRHR2: This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. Also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 2; Membrane protein, multi-pass

Cellular Component: Golgi apparatus; cell surface; cell soma; rough endoplasmic reticulum; axon; endoplasmic reticulum; dendrite; integral to membrane; plasma membrane; perikaryon; nerve terminal

Molecular Function: G-protein coupled receptor activity; corticotropin-releasing hormone receptor activity; peptide hormone binding; hormone activity; corticotrophin-releasing factor receptor activity

Biological Process: hypothalamus development; hormone-mediated signaling; positive regulation of serotonin secretion; actin filament organization; positive regulation of interleukin-6 production; positive regulation of heart rate; positive regulation of cAMP metabolic process; sensory perception of pain; positive regulation of stress-activated MAPK cascade; activation of NF-kappaB transcription factor; negative regulation of follicle-stimulating hormone secretion; negative regulation of luteinizing hormone secretion; G-protein coupled receptor protein signaling pathway; negative regulation of cAMP biosynthetic process; negative regulation of angiogenesis; catecholamine biosynthetic process; epithelial cell differentiation; protein kinase C activation; positive regulation of cAMP biosynthetic process; negative regulation of epinephrine secretion; cerebellum development; feeding behavior; skeletal muscle growth; positive regulation of blood pressure

Research Articles on Crhr2

Similar Products

Product Notes

The Crhr2 crhr2 (Catalog #AAA949810) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-411. The amino acid sequence is listed below: LAEELLLDGW GEPPDPEGPY SYCNTTLDQI GTCWPQSAPG ALVERPCPEY FNGIKYNTTR NAYRECLENG TWASRINYSH CEPILDDKQR KYDLHYRIAL IINYLGHCVS VVALVAAFLL FLVLRSIRCL RNVIHWNLIT TFILRNITWF LLQLIDHEVH EGNEVWCRCV TTIFNYFVVT NFFWMFVEGC YLHTAIVMTY STEHLRKWLF LFIGWCIPCP IIVAWAVGKL YYENEQCWFG KEPGDLVDYI YQGPIILVLL INFVFLFNIV RILMTKLRAS TTSETIQYRK AVKATLVLLP LLGITYMLFF VNPGEDDLSQ IVFIYFNSFL QSFQGFFVSV FYCFFNGEVR SALRKRWHRW QDHHALRVPV ARAMSIPTSP TRISFHSIKQ TAAV. It is sometimes possible for the material contained within the vial of "Corticotropin-releasing factor receptor 2 (Crhr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.