Glucagon-like peptide 1 receptor (GLP1R) Recombinant Protein | GLP1R recombinant protein

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Cat. Num. AAA949592

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glucagon-like peptide 1 receptor (GLP1R); Recombinant Human Glucagon-like peptide 1 receptor (GLP1R); partial; GLP1R recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-145aa; partial
• Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

• Production Note: Special Offer: The Baculovirus, E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for GLP1R recombinant protein

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Product Categories/Family for GLP1R recombinant protein

Cardiovascular

References

Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.Thorens B., Porret A., Buehler L., Deng S., Morel P., Widmann C.Diabetes 42:1678-1682(1993) Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.Dillon J.S., Tanizawa Y., Wheeler M.B., Leng X., Ligon B.B., Rabin D.U., Yoo-Warren H., Permutt M., Boyd A.E.Endocrinology 133:1907-1910(1993) Cloning and functional expression of a human glucagon-like peptide-1 receptor.Graziano M.P., Hey P.J., Borkowski D., Chicchi G.C., Strader C.D.Biochem. Biophys. Res. Commun. 196:141-146(1993) Signal transduction of the GLP-1-receptor cloned from a human insulinoma.van Eyll B., Lankat-Buttgereit B., Bode H.P., Goeke R., Goeke B.FEBS Lett. 348:7-13(1994) Tissue-specific expression of the human receptor for glucagon-like peptide-I brain, heart and pancreatic forms have the same deduced amino acid sequences.Wei Y., Mojsov S.FEBS Lett. 358:219-224(1995) Genome-wide discovery and analysis of human seven transmembrane helix receptor genes.Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.NIEHS SNPs programThe DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Cloning and characterization of the 5' flanking sequences (promoter region) of the human GLP-1 receptor gene.Lankat-Buttgereit B., Goeke B.Peptides 18:617-624(1997) Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1) receptor indicates a disulfide bond that is close to the activation pocket.Mann R.J., Al-Sabah S., de Maturana R.L., Sinfield J.K., Donnelly D.Peptides 31:2289-2293(2010) Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.Dezelak M., Bavec A.Mol. Biol. Rep. 39:4375-4381(2012) Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675(2012) Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.Runge S., Thogersen H., Madsen K., Lau J., Rudolph R.J. Biol. Chem. 283:11340-11347(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 166795283
• NCBI GeneID: 2740
• NCBI Accession #: NP_002053.3
• NCBI GenBank Nucleotide #: NM_002062.3
• UniProt Accession #: P43220; Q2M229; Q99669
• Molecular Weight: 16.3 kDa
• NCBI Official Full Name: glucagon-like peptide 1 receptor
• NCBI Official Synonym Full Names: glucagon like peptide 1 receptor
• NCBI Official Symbol: GLP1R
• NCBI Protein Information: glucagon-like peptide 1 receptor
• UniProt Protein Name: Glucagon-like peptide 1 receptor
• Protein Family: Glucagon-like peptide 1 receptor
• UniProt Gene Name: GLP1R
• UniProt Synonym Gene Names: GLP-1 receptor; GLP-1-R; GLP-1R
• UniProt Entry Name: GLP1R_HUMAN

NCBI Description

This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 2; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: cytosol; integral to membrane; intracellular; plasma membrane

Molecular Function: glucagon receptor activity; protein binding; transmembrane receptor activity

Biological Process: adenylate cyclase activation; cAMP-mediated signaling; cell surface receptor linked signal transduction; elevation of cytosolic calcium ion concentration; energy reserve metabolic process; G-protein coupled receptor protein signaling pathway; learning and/or memory; positive regulation of blood pressure; regulation of heart contraction; regulation of insulin secretion; response to stress