CCAAT/enhancer-binding protein epsilon (Cebpe) Recombinant Protein | Cebpe recombinant protein
Recombinant Rat CCAAT/enhancer-binding protein epsilon (Cebpe)
Gene Names
Cebpe; CRP1; C/EPBe
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CCAAT/enhancer-binding protein epsilon (Cebpe); Recombinant Rat CCAAT/enhancer-binding protein epsilon (Cebpe); Cebpe recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-281, Full length protein
Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAMKPTPEARSLKGPGTPSFPHYLPADPRPFAYPSHTFGPDRKALGPGIYSNPGSYDPRAVAVKEEPRGPEGNRGTGRGSYNPLQYQVAHCGQTAVHLPPTLAAPGQPLRVLKAPVAAAAPPCSPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERLRSRVDQLTQELDTLRNLFRQIPEAASLIKGVGGCS
Sequence Length
281
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cebpe recombinant protein
This protein is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,590 Da
NCBI Official Full Name
CCAAT/enhancer-binding protein epsilon
NCBI Official Synonym Full Names
CCAAT/enhancer binding protein epsilon
NCBI Official Symbol
Cebpe
NCBI Official Synonym Symbols
CRP1; C/EPBe
NCBI Protein Information
CCAAT/enhancer-binding protein epsilon
UniProt Protein Name
CCAAT/enhancer-binding protein epsilon
Protein Family
UniProt Gene Name
Cebpe
UniProt Synonym Gene Names
; C/EBP epsilon
NCBI Description
basic region/leucine zipper transcriptional activator; may mediate cytokine gene expression in mature cells; may play a role in macrophage development [RGD, Feb 2006]
Uniprot Description
Transcriptional activator. C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-myelocyte transition in myeloid differentiation.
Similar Products
Product Notes
The Cebpe cebpe (Catalog #AAA949151) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-281, Full length protein. The amino acid sequence is listed below: MSHGTYYECE PRGGQQPLEF SGGRAGPGEL GDMCEHEASI DLSAYIESGE EQLLSDLFAM KPTPEARSLK GPGTPSFPHY LPADPRPFAY PSHTFGPDRK ALGPGIYSNP GSYDPRAVAV KEEPRGPEGN RGTGRGSYNP LQYQVAHCGQ TAVHLPPTLA APGQPLRVLK APVAAAAPPC SPLLKAPSPA GPSHKGKKAV NKDSLEYRLR RERNNIAVRK SRDKAKRRIM ETQQKVLEYM AENERLRSRV DQLTQELDTL RNLFRQIPEA ASLIKGVGGC S. It is sometimes possible for the material contained within the vial of "CCAAT/enhancer-binding protein epsilon (Cebpe), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
