Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (PLOD1) Recombinant Protein | PLOD1 recombinant protein
Recombinant Chicken Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (PLOD1), partial
Gene Names
PLOD1; PLOD; procollagen-lysine
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Procollagen-lysine; 2-oxoglutarate 5-dioxygenase 1 (PLOD1); Recombinant Chicken Procollagen-lysine; partial; PLOD1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
514-730. Fragment at the C-terminal, including the Fe2OG dioxygenase domain
Sequence
YQTTHLHNDLWQIFSNPEDWREKYIHENYTAALKGKLVEMPCPDVYWFPIFTDTACDELVEEMEHYGKWSTGDNTDSRIQGGYENVPTIDIHMNQIGFEREWYKFLLDYIAPITEKLYPGYYTKTQFELAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGIDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTKGTRYIAVSFIDP
Sequence Length
730
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PLOD1 recombinant protein
Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,318 Da
NCBI Official Full Name
procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
NCBI Official Synonym Full Names
procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1
NCBI Official Symbol
PLOD1
NCBI Official Synonym Symbols
PLOD; procollagen-lysine
NCBI Protein Information
procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
UniProt Protein Name
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
Protein Family
UniProt Gene Name
PLOD1
UniProt Synonym Gene Names
PLOD; LH1
Uniprot Description
Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
Similar Products
Product Notes
The PLOD1 plod1 (Catalog #AAA948221) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 514-730. Fragment at the C-terminal, including the Fe2OG dioxygenase domain. The amino acid sequence is listed below: YQTTHLHNDL WQIFSNPEDW REKYIHENYT AALKGKLVEM PCPDVYWFPI FTDTACDELV EEMEHYGKWS TGDNTDSRIQ GGYENVPTID IHMNQIGFER EWYKFLLDYI APITEKLYPG YYTKTQFELA FVVRYKPDEQ PSLMPHHDAS TFTINIALNR VGIDYEGGGC RFLRYNCSIR APRKGWTLMH PGRLTHYHEG LPTTKGTRYI AVSFIDP . It is sometimes possible for the material contained within the vial of "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (PLOD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
