Dynamin-1 Recombinant Protein | DYN1 recombinant protein

Recombinant Homo sapiens Dynamin-1

Cat. Num. AAA9422266

• Gene Names: DNM1; DNM; EIEE31
• Reactivity: Human
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Dynamin-1; Recombinant Homo sapiens Dynamin-1; DYN1 recombinant protein

• Host: Yeast
• Reactivity: Human
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: 20mM Tris-HCl based buffer, pH8.0
• Sequence Positions: Partial, 2-245aa
• Sequence: GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

• Calculated MW: 28.73 kD
• Tag Info: His-tag
• Preparation and Storage: Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Related Product Information for DYN1 recombinant protein

Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

NCBI and Uniprot Product Information

• NCBI GI #: 56549117
• NCBI GeneID: 1759
• NCBI Accession #: NP_001005336.1
• NCBI GenBank Nucleotide #: NM_001005336.2
• UniProt Accession #: Q05193; Q5SYX0; Q5SYX2; Q6P3T6; Q86VD2; A6NLM6
• NCBI Official Full Name: dynamin-1 isoform 2
• NCBI Official Synonym Full Names: dynamin 1
• NCBI Official Symbol: DNM1
• NCBI Official Synonym Symbols: DNM; EIEE31
• NCBI Protein Information: dynamin-1
• UniProt Protein Name: Dynamin-1
• Protein Family: Dynamin
• UniProt Gene Name: DNM1
• UniProt Synonym Gene Names: DNM

NCBI Description

This gene encodes a member of the dynamin subfamily of GTP-binding proteins. The encoded protein possesses unique mechanochemical properties used to tubulate and sever membranes, and is involved in clathrin-mediated endocytosis and other vesicular trafficking processes. Actin and other cytoskeletal proteins act as binding partners for the encoded protein, which can also self-assemble leading to stimulation of GTPase activity. More than sixty highly conserved copies of the 3' region of this gene are found elsewhere in the genome, particularly on chromosomes Y and 15. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DYN1: a microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Concentrates within the presynaptic compartment and may participate in specialized neuronal functions such as rapid synaptic vesicle recycling. Part of a protein network that controls nucleation of actin from membranes. Contains one PH domain.

Protein type: EC 3.6.5.5; Hydrolase; Microtubule-binding; Motility/polarity/chemotaxis; Motor; Vesicle

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: mitochondrial membrane; plasma membrane

Molecular Function: GTPase activity; identical protein binding; microtubule binding; protein binding; protein kinase binding; RNA binding

Biological Process: endocytosis; endosome organization and biogenesis; ephrin receptor signaling pathway; mitochondrial fission; receptor-mediated endocytosis

Disease: Epileptic Encephalopathy, Early Infantile, 31