Nuclear receptor ROR-gamma Recombinant Protein | RORG recombinant protein
Recombinant Human Nuclear receptor ROR-gamma
KAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIAL YTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQI FQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
RORC: Possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. Involved in lineage specification of uncommitted CD4(+) T-helper cells into Th17 cells. Regulate the expression of several components of the circadian clock. Belongs to the nuclear hormone receptor family. NR1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: DNA-binding; Nuclear receptor; Transcription factor
Chromosomal Location of Human Ortholog: 1q21.3
Cellular Component: nuclear body; nucleoplasm; nucleus
Molecular Function: oxysterol binding; protein binding; transcription factor activity
Biological Process: circadian regulation of gene expression; positive regulation of circadian rhythm; positive regulation of transcription, DNA-dependent; regulation of fat cell differentiation; regulation of steroid metabolic process; transcription initiation from RNA polymerase II promoter; xenobiotic metabolic process
Disease: Immunodeficiency 42
Research Articles on RORG
Similar Products
Product Notes
The RORG rorc (Catalog #AAA9420623) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-518aa. The Recombinant Human Nuclear receptor ROR-gamma reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MDRAPQRQHR ASRELLAAKK THTSQIEVIP CKICGDKSSG IHYGVITCEG CKGFFRRSQR CNAAYSCTRQ QNC PIDRT SRNRCQHCRL QKCLALGMSR DAVKFGRMSK KQRDSLHAEV QKQLQQRQQQ QQEPVVKTPP AGAQG ADT LTYTLGLPDG QLPLGSSPDL PEASACPPGL LKASGSGPSY SNNLAKAGLN GASCHLEYSP ERGKAEGRE SFYSTGSQL TPDRCGLRFE EHRHPGLGEL GQGPDSYGSP SFRSTPEAPY ASLTEIEHLV QSVCKSYRET CQL RLEDL LRQRSNIFSR EEVTGYQRKS MWEMWERCAH HLTEAIQYVV EFAKRLSGFM ELCQNDQIVL L KAG AMEVVLVRMC RAYNADNRTV FFEGKYGGME LFRALGCSEL ISSIFDFSHS LSALHFSEDE IAL YTALV LINAHRPGLQ EKRKVEQLQY NLELAFHHHL CKTHRQSILA KLPPKGKLRS LCSQHVERLQ I FQHLHPI VVQAAFPPLY KELFSTETES PVGLSK. It is sometimes possible for the material contained within the vial of "Nuclear receptor ROR-gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.