Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of mouse stomach, using RPL35A antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

Rabbit anti-Mouse, Rat RPL35A Polyclonal Antibody | anti-RPL35A antibody

RPL35A Rabbit pAb

Gene Names
RPL35A; DBA5; L35A
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
RPL35A; Polyclonal Antibody; RPL35A Rabbit pAb; DBA5; L35A; anti-RPL35A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRS
Applicable Applications for anti-RPL35A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2).
Positive Samples
mouse stomach
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse stomach, using RPL35A antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

Western Blot (WB) (Western blot analysis of extracts of mouse stomach, using RPL35A antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
Product Categories/Family for anti-RPL35A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,538 Da
NCBI Official Full Name
60S ribosomal protein L35a
NCBI Official Synonym Full Names
ribosomal protein L35a
NCBI Official Symbol
RPL35A
NCBI Official Synonym Symbols
DBA5; L35A
NCBI Protein Information
60S ribosomal protein L35a; cell growth-inhibiting gene 33 protein
UniProt Protein Name
60S ribosomal protein L35a
Protein Family
UniProt Gene Name
RPL35A
UniProt Entry Name
RL35A_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L35AE family of ribosomal proteins. It is located in the cytoplasm. The rat protein has been shown to bind to both initiator and elongator tRNAs, and thus, it is located at the P site, or P and A sites, of the ribosome. Although this gene was originally mapped to chromosome 18, it has been established that it is located at 3q29-qter. Transcript variants utilizing alternative transcription initiation sites and alternative polyA signals exist. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPL35A: Required for the proliferation and viability of hematopoietic cells. Plays a role in 60S ribosomal subunit formation. The protein was found to bind to both initiator and elongator tRNAs and consequently was assigned to the P site or P and A site. Defects in RPL35A are the cause of Diamond-Blackfan anemia type 5 (DBA5). DBA5 is a form of Diamond- Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies. Belongs to the ribosomal protein L35Ae family.

Protein type: RNA-binding; Ribosomal; Translation

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: membrane; mitochondrion; cytosol

Molecular Function: structural constituent of ribosome; tRNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translation; viral reproduction; translational termination; viral infectious cycle; ribosomal large subunit biogenesis and assembly; cellular protein metabolic process; translational elongation; mRNA catabolic process, nonsense-mediated decay; translational initiation; viral transcription; gene expression; rRNA processing

Disease: Diamond-blackfan Anemia 5

Research Articles on RPL35A

Similar Products

Product Notes

The RPL35A rpl35a (Catalog #AAA9143108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL35A Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPL35A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RPL35A rpl35a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IFAGYKRGLR NQREHTALLK IEGVYARDET EFYLGKRCAY VYKAKNNTVT PGGKPNKTRV IWGKVTRAHG NSGMVRAKFR S. It is sometimes possible for the material contained within the vial of "RPL35A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.