Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using HSPA4L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Rabbit HSPA4L Polyclonal Antibody | anti-HSPA4L antibody
HSPA4L Rabbit pAb
Gene Names
HSPA4L; APG-1; HSPH3; Osp94
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
HSPA4L; Polyclonal Antibody; HSPA4L Rabbit pAb; APG-1; HSPH3; Osp94; anti-HSPA4L antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
Applicable Applications for anti-HSPA4L antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HSPA4L (NP_055093.2).
Positive Samples
U-87MG, K-562, HeLa, Mouse brain, Rat testis, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using HSPA4L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using HSPA4L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Immunofluorescence (IF)
(Immunofluorescence analysis of A431 cells using HSPA4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of A431 cells using HSPA4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-HSPA4L antibody
Background: The protein encoded by this gene is heat shock inducible and may act as a chaperone. The encoded protein can protect the heat-shocked cell against the harmful effects of aggregated proteins. This gene is highly expressed in leukemia cells and may be a good target for therapeutic intervention. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
94,512 Da
NCBI Official Full Name
heat shock 70 kDa protein 4L isoform 1
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 4 like
NCBI Official Symbol
HSPA4L
NCBI Official Synonym Symbols
APG-1; HSPH3; Osp94
NCBI Protein Information
heat shock 70 kDa protein 4L
UniProt Protein Name
Heat shock 70 kDa protein 4L
Protein Family
UniProt Gene Name
HSPA4L
UniProt Synonym Gene Names
APG1; OSP94
NCBI Description
The protein encoded by this gene is heat shock inducible and may act as a chaperone. The encoded protein can protect the heat-shocked cell against the harmful effects of aggregated proteins. This gene is highly expressed in leukemia cells and may be a good target for therapeutic intervention. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Uniprot Description
Possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Research Articles on HSPA4L
Similar Products
Product Notes
The HSPA4L hspa4l (Catalog #AAA9142898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA4L Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA4L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the HSPA4L hspa4l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KQNLEGDHSD APMETETSFK NENKDNMDKM QVDQEEGHQK CHAEHTPEEE IDHTGAKTKS AVSDKQDRLN QTLKKGKVKS IDLPIQSSLC RQLGQDLLNS Y. It is sometimes possible for the material contained within the vial of "HSPA4L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
