Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LY86 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Mouse LY86 Polyclonal Antibody | anti-LY86 antibody

LY86 Rabbit pAb

Gene Names
LY86; MD1; MD-1; MMD-1; dJ80N2.1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
LY86; Polyclonal Antibody; LY86 Rabbit pAb; MD-1; MD1; MMD-1; dJ80N2.1; anti-LY86 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
Applicable Applications for anti-LY86 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human LY86 (NP_004262.1).
Cellular Location
Secreted, extracellular space
Positive Samples
Jurkat, LO2, U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using LY86 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LY86 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,906 Da
NCBI Official Full Name
lymphocyte antigen 86
NCBI Official Synonym Full Names
lymphocyte antigen 86
NCBI Official Symbol
LY86
NCBI Official Synonym Symbols
MD1; MD-1; MMD-1; dJ80N2.1
NCBI Protein Information
lymphocyte antigen 86; MD-1, RP105-associated; ly-86; protein MD-1
UniProt Protein Name
Lymphocyte antigen 86
Protein Family
UniProt Gene Name
LY86
UniProt Synonym Gene Names
MD1; Ly-86
UniProt Entry Name
LY86_HUMAN

Uniprot Description

LY86: May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression.

Protein type: Secreted; Apoptosis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p25.1

Cellular Component: extracellular space; plasma membrane

Biological Process: cell proliferation; apoptosis; positive regulation of lipopolysaccharide-mediated signaling pathway; innate immune response; inflammatory response; humoral immune response

Research Articles on LY86

Similar Products

Product Notes

The LY86 ly86 (Catalog #AAA9142595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LY86 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LY86 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the LY86 ly86 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DFGFSVEKCS KQLKSNINIR FGIILREDIK ELFLDLALMS QGSSVLNFSY PICEAALPKF SFCGRRKGEQ IYYAGPVNNP EFTIPQGEYQ VLLELYTEKR S. It is sometimes possible for the material contained within the vial of "LY86, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.