Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SRF antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Rabbit anti-Human, Mouse SRF Polyclonal Antibody | anti-SRF antibody

SRF Rabbit pAb

Gene Names
SRF; MCM1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SRF; Polyclonal Antibody; SRF Rabbit pAb; MCM1; anti-SRF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ
Applicable Applications for anti-SRF antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human SRF (NP_003122.1).
Cellular Location
Nucleus
Positive Samples
Mouse liver, Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SRF antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SRF antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-SRF antibody
Background: This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,593 Da
NCBI Official Full Name
serum response factor
NCBI Official Synonym Full Names
serum response factor (c-fos serum response element-binding transcription factor)
NCBI Official Symbol
SRF
NCBI Official Synonym Symbols
MCM1
NCBI Protein Information
serum response factor
UniProt Protein Name
Serum response factor
Protein Family
UniProt Gene Name
SRF
UniProt Synonym Gene Names
SRF
UniProt Entry Name
SRF_HUMAN

NCBI Description

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). [provided by RefSeq, Jul 2008]

Uniprot Description

SRF: a transcription factor of the MADS domain family that binds to the serum response element (SRE). Regulates the transcription of immediate early genes including c-fos. Binds DNA as a multimer, probably a dimer.

Protein type: Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein homodimerization activity; chromatin DNA binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; developmental growth; erythrocyte development; positive regulation of transcription by glucose; cell-matrix adhesion; response to toxin; heart development; positive regulation of axon extension; response to hormone stimulus; neuron migration; cardiac myofibril assembly; muscle maintenance; negative regulation of cell proliferation; tangential migration from the subventricular zone to the olfactory bulb; regulation of smooth muscle cell differentiation; morphogenesis of an epithelial sheet; positive regulation of smooth muscle contraction; heart looping; negative regulation of cell migration; neurite development; associative learning; positive thymic T cell selection; positive regulation of filopodium formation; regulation of cell adhesion; platelet activation; skin morphogenesis; hippocampus development; sarcomere organization; angiogenesis involved in wound healing; mRNA transcription from RNA polymerase II promoter; trophectodermal cell differentiation; regulation of water loss via skin; patterning of blood vessels; contractile actin filament bundle formation; mesoderm formation; long-term memory; cell migration during sprouting angiogenesis; response to cytokine stimulus; stress fiber formation; response to hypoxia; neuron development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; platelet formation; positive regulation of cell differentiation

Research Articles on SRF

Similar Products

Product Notes

The SRF srf (Catalog #AAA9142423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRF Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SRF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SRF srf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLPTQAGAAA ALGRGSALGG SLNRTPTGRP GGGGGTRGAN GGRVPGNGAG LGPGRLEREA AAAAATTPAP TAGALYSGSE GDSESGEEEE LGAERRGLKR SLSEMEIGMV VGGPEASAAA TGGYGPVSGA VSGAKPGKKT RGRVKIKMEF IDNKLRRYTT FSKRKTGIMK KAYELSTLTG TQVLLLVASE TGHVYTFATR KLQPMITSET GKALIQTCLN SPDSPPRSDP TTDQRMSATG FEETDLTYQV SESDSSGETK DTLKPAFTVT NLPGTTSTIQ. It is sometimes possible for the material contained within the vial of "SRF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.