Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Rat RCBTB1 Polyclonal Antibody | anti-RCBTB1 antibody

RCBTB1 Rabbit pAb

Gene Names
RCBTB1; GLP; CLLD7; CLLL7; RP11-185C18.1
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
RCBTB1; Polyclonal Antibody; RCBTB1 Rabbit pAb; CLLD7; CLLL7; GLP; RDEOA; anti-RCBTB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQ
Applicable Applications for anti-RCBTB1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RCBTB1 (NP_060661.3).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-RCBTB1 antibody
Background: This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,252 Da
NCBI Official Full Name
RCC1 and BTB domain-containing protein 1
NCBI Official Synonym Full Names
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
NCBI Official Symbol
RCBTB1
NCBI Official Synonym Symbols
GLP; CLLD7; CLLL7; RP11-185C18.1
NCBI Protein Information
RCC1 and BTB domain-containing protein 1; CLL deletion region gene 7 protein; GDP/GTP exchange factor (GEF)-like protein; chronic lymphocytic leukemia deletion region gene 7 protein; regulator of chromosome condensation and BTB domain-containing protein 1
UniProt Protein Name
RCC1 and BTB domain-containing protein 1
UniProt Gene Name
RCBTB1
UniProt Synonym Gene Names
CLLD7; E4.5; CLL deletion region gene 7 protein
UniProt Entry Name
RCBT1_HUMAN

NCBI Description

This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq, Jul 2008]

Uniprot Description

RCBTB1: May be involved in cell cycle regulation by chromatin remodeling. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; Cell cycle regulation

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: cytoplasm; nucleus

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; chromatin modification; cell cycle

Disease: Alcohol Dependence

Research Articles on RCBTB1

Similar Products

Product Notes

The RCBTB1 rcbtb1 (Catalog #AAA9142354) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCBTB1 Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RCBTB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RCBTB1 rcbtb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVDVGKWPIF TLLSPQEIAS IRKACVFGTS ASEALYVTDN DEVFVFGLNY SNCLGTGDNQ STLVPKKLEG LCGKKIKSLS YGSGPHVLLS TEDGVVYAWG HNGYSQLGNG TTNQGIAPVQ. It is sometimes possible for the material contained within the vial of "RCBTB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.