Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse SMARCAL1 Polyclonal Antibody | anti-SMARCAL1 antibody

SMARCAL1 Rabbit pAb

Gene Names
SMARCAL1; HARP; HHARP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SMARCAL1; Polyclonal Antibody; SMARCAL1 Rabbit pAb; HARP; HHARP; anti-SMARCAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
VFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELL
Applicable Applications for anti-SMARCAL1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SMARCAL1 (NP_001120679.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-SMARCAL1 antibody
Background: The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E Coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the test features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.
Product Categories/Family for anti-SMARCAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
954
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1
NCBI Official Symbol
SMARCAL1
NCBI Official Synonym Symbols
HARP; HHARP
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1; HepA-related protein; SMARCA-like protein 1; ATP-driven annealing helicase; sucrose nonfermenting protein 2-like 1
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
UniProt Gene Name
SMARCAL1
UniProt Synonym Gene Names
HARP; hHARP
UniProt Entry Name
SMAL1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

SMARCAL1: ATP-dependent annealing helicase that catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA. Defects in SMARCAL1 are a cause of Schimke immuno-osseous dysplasia (SIOD). SIOD causes spondyloepiphyseal dysplasia, renal dysfunction and T-cell immunodeficiency. Approximately half of all patients also exhibit hyperthyroidism, while around half also exhibit episodal cerebral ischema. Belongs to the SNF2/RAD54 helicase family. SMARCAL1 subfamily.

Protein type: EC 3.6.4.-; EC 3.6.1.-; Helicase

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleoplasm; DNA replication factor A complex; nucleus

Molecular Function: DNA-dependent ATPase activity; protein binding; DNA binding; helicase activity; ATP binding

Biological Process: regulation of transcription from RNA polymerase II promoter; DNA strand renaturation; chromatin modification; DNA repair; response to DNA damage stimulus; DNA metabolic process; replication fork processing

Disease: Immunoosseous Dysplasia, Schimke Type

Research Articles on SMARCAL1

Similar Products

Product Notes

The SMARCAL1 smarcal1 (Catalog #AAA9142345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMARCAL1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SMARCAL1 smarcal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VFAELFWNPG VLIQAEDRVH RIGQTSSVGI HYLVAKGTAD DYLWPLIQEK IKVLAEAGLS ETNFSEMTES TDYLYKDPKQ QKIYDLFQKS FEKEGSDMEL L. It is sometimes possible for the material contained within the vial of "SMARCAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.