Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Mouse TAF6 Polyclonal Antibody | anti-TAF6 antibody

TAF6 Rabbit pAb

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
TAF6; Polyclonal Antibody; TAF6 Rabbit pAb; ALYUS; MGC:8964; TAF(II)70; TAF(II)80; TAF2E; TAFII-70; TAFII-80; TAFII70; TAFII80; TAFII85; anti-TAF6 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLC
Applicable Applications for anti-TAF6 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TAF6 (XP_006716164.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-TAF6 antibody
Background: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TAF6 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 71kDa/72kDa/76kDa
UniProt Protein Name
Transcription initiation factor TFIID subunit 6
UniProt Gene Name
TAF6
UniProt Synonym Gene Names
TAF2E; TAFII70
UniProt Entry Name
TAF6_HUMAN

Uniprot Description

TAF6: TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Belongs to the TAF6 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleoplasm; transcription factor TFIID complex; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of cell proliferation; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; regulation of transcription factor activity; viral reproduction; RNA elongation from RNA polymerase II promoter; transcription initiation; gene expression; negative regulation of cell cycle

Similar Products

Product Notes

The TAF6 taf6 (Catalog #AAA9142317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF6 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TAF6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TAF6 taf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TKSWVDEKTP WTTRYGSIAG LAELGHDVIK TLILPRLQQE GERIRSVLDG PVLSNIDRIG ADHVQSLLLK HCAPVLAKLR PPPDNQDAYR AEFGSLGPLL C. It is sometimes possible for the material contained within the vial of "TAF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual