Rabbit anti-Human, Mouse Furin Polyclonal Antibody | anti-Furin antibody

Furin Rabbit pAb

Cat. Num. AAA9142309

• Gene Names: FURIN; FUR; PACE; SPC1; PCSK3
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: Furin; Polyclonal Antibody; Furin Rabbit pAb; FURIN; FUR; PACE; PCSK3; SPC1; furin; anti-Furin antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: AGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL

• Applicable Applications for anti-Furin antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: WB: 1:500-1:2000; IP: 1:50-1:200
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human Furin (NP_002560.1).
• Cellular Location: Cell membrane, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network membrane
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Related Product Information for anti-Furin antibody

Background: This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membrane bound protease that is expressed in many tissues, including neuroendocrine, liver, gut, and brain. The encoded protein undergoes an initial autocatalytic processing event in the ER and then sorts to the trans-Golgi network through endosomes where a second autocatalytic event takes place and the catalytic activity is acquired. The product of this gene is one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include proparathyroid hormone, transforming growth factor beta 1 precursor, proalbumin, pro-beta-secretase, membrane type-1 matrix metalloproteinase, beta subunit of pro-nerve growth factor and von Willebrand factor. It is also thought to be one of the proteases responsible for the activation of HIV envelope glycoproteins gp160 and gp140 and may play a role in tumor progression. This gene is located in close proximity to family member proprotein convertase subtilisin/kexin type 6 and upstream of the FES oncogene. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-Furin antibody

Cell Biology & Developmental Biology; Notch Signaling Pathway

NCBI and Uniprot Product Information

• NCBI GI #: 577019578
• NCBI GeneID: 5045
• NCBI Accession #: NP_001276752.1
• NCBI GenBank Nucleotide #: NM_001289823.1
• UniProt Accession #: P09958; Q14336; Q6LBS3; Q9UCZ5
• Molecular Weight: 86,678 Da
• NCBI Official Full Name: furin preproprotein
• NCBI Official Synonym Full Names: furin, paired basic amino acid cleaving enzyme
• NCBI Official Symbol: FURIN
• NCBI Official Synonym Symbols: FUR; PACE; SPC1; PCSK3
• NCBI Protein Information: furin
• UniProt Protein Name: Furin
• Protein Family: Furin
• UniProt Gene Name: FURIN
• UniProt Synonym Gene Names: FUR; PACE; PCSK3; PACE
• UniProt Entry Name: FURIN_HUMAN

Uniprot Description

FURIN: Furin is likely to represent the ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RX(K/R)R consensus motif. Belongs to the peptidase S8 family. Furin subfamily.

Protein type: Cell surface; EC 3.4.21.75; Membrane protein, integral; Protease; Vesicle

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: cell surface; endoplasmic reticulum; extracellular space; Golgi lumen; Golgi membrane; lipid raft; membrane; plasma membrane; trans-Golgi network; trans-Golgi network transport vesicle

Molecular Function: endopeptidase activity; nerve growth factor binding; peptidase activity; peptide binding; protease binding; protein binding; serine-type endopeptidase activity; serine-type endopeptidase inhibitor activity

Biological Process: cell proliferation; cellular protein metabolic process; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; negative regulation of low-density lipoprotein receptor catabolic process; negative regulation of nerve growth factor production; negative regulation of transforming growth factor-beta1 production; nerve growth factor processing; nerve growth factor production; peptide biosynthetic process; peptide hormone processing; positive regulation of membrane protein ectodomain proteolysis; protein processing; regulation of endopeptidase activity; regulation of protein catabolic process; secretion by cell; signal peptide processing; transforming growth factor beta receptor signaling pathway; viral infectious cycle; viral protein processing