Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UBAC2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Rabbit anti-Mouse UBAC2 Polyclonal Antibody | anti-UBAC2 antibody
UBAC2 Rabbit pAb
Gene Names
UBAC2; PHGDHL1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
UBAC2; Polyclonal Antibody; UBAC2 Rabbit pAb; PHGDHL1; anti-UBAC2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV
Applicable Applications for anti-UBAC2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1).
Cellular Location
Endoplasmic reticulum membrane, Multi-pass membrane protein
Positive Samples
Mouse kidney, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UBAC2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UBAC2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,964 Da
NCBI Official Full Name
ubiquitin-associated domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
UBA domain containing 2
NCBI Official Symbol
UBAC2
NCBI Official Synonym Symbols
PHGDHL1
NCBI Protein Information
ubiquitin-associated domain-containing protein 2; RP11-178C10.1; UBA domain-containing protein 2; phosphoglycerate dehydrogenase like 1; phosphoglycerate dehydrogenase-like protein 1
UniProt Protein Name
Ubiquitin-associated domain-containing protein 2
Protein Family
UniProt Gene Name
UBAC2
UniProt Synonym Gene Names
PHGDHL1; UBA domain-containing protein 2
UniProt Entry Name
UBAC2_HUMAN
Uniprot Description
UBAC2: 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 13q32.3
Cellular Component: endoplasmic reticulum; integral to membrane
Research Articles on UBAC2
Similar Products
Product Notes
The UBAC2 ubac2 (Catalog #AAA9142133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBAC2 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UBAC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the UBAC2 ubac2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PIFSSSEPTS EARIGMGATL DIQRQQRMEL LDRQLMFSQF AQGRRQRQQQ GGMINWNRLF PPLRQRQNVN YQGGRQSEPA APPLEVSEEQ V. It is sometimes possible for the material contained within the vial of "UBAC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
