Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-20RB Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-85 kDa.)

IL-20RB recombinant protein

Recombinant Human IL-20RB Protein

Gene Names
IL20RB; DIRS1; FNDC6; IL-20R2
Purity
>95% by SDS-PAGE.
Synonyms
IL-20RB; Recombinant Human IL-20RB Protein; Interleukin-20 receptor subunit beta; IL-20 receptor subunit beta; IL-20R-beta; IL20R2; DIRS1; hCG_2022374; FNDC6; MGC34923; fibronectin type III domain containing 6; interleukin-20 receptor II; IL-20RB recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Supplied as a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
Sequence Length
311
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Tag
Fc tag at the C-terminus
Preparation and Storage
This product is stable at <= ?70 degree C for up to 1 year from the date of receipt.
For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Avoid repeated freeze-thaw cycles.

SDS-Page

(Recombinant Human IL-20RB Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-85 kDa.)

SDS-Page (Recombinant Human IL-20RB Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-85 kDa.)
Related Product Information for IL-20RB recombinant protein
Description: Recombinant Human IL-20RB Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp30-Ala230) of human IL-20RB (Accession #Q6UXL0) fused with an Fc tag at the C-terminus.

Background: IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).
Product Categories/Family for IL-20RB recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-20 receptor subunit beta
NCBI Official Synonym Full Names
interleukin 20 receptor subunit beta
NCBI Official Symbol
IL20RB
NCBI Official Synonym Symbols
DIRS1; FNDC6; IL-20R2
NCBI Protein Information
interleukin-20 receptor subunit beta
UniProt Protein Name
Interleukin-20 receptor subunit beta
UniProt Gene Name
IL20RB
UniProt Synonym Gene Names
DIRS1; IL-20 receptor subunit beta; IL-20R-beta; IL-20RB
UniProt Entry Name
I20RB_HUMAN

NCBI Description

IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM, Feb 2009]

Uniprot Description

IL20RB: The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24. Belongs to the type II cytokine receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: integral to membrane; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-20 binding

Biological Process: positive regulation of interleukin-4 production; negative regulation of T cell proliferation; inflammatory response to antigenic stimulus; homeostasis of number of cells within a tissue; immune response-inhibiting signal transduction; negative regulation of interferon-gamma production; cytokine and chemokine mediated signaling pathway; negative regulation of type IV hypersensitivity; positive regulation of interleukin-10 production; negative regulation of interleukin-2 production

Research Articles on IL-20RB

Similar Products

Product Notes

The IL-20RB il20rb (Catalog #AAA9141917) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DEVAILPAPQ NLSVLSTNMK HLLMWSPVIA PGETVYYSVE YQGEYESLYT SHIWIPSSWC SLTEGPECDV TDDITATVPY NLRVRATLGS QTSAWSILKH PFNRNSTILT RPGMEITKDG FHLVIELEDL GPQFEFLVAY WRREPGAEEH VKMVRSGGIP VHLETMEPGA AYCVKAQTFV KAIGRYSAFS QTECVEVQGE A. It is sometimes possible for the material contained within the vial of "IL-20RB, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.