Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human AGER/RAGE Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 100 kDa.)

AGER/RAGE active protein

Recombinant Human AGER/RAGE Protein

Gene Names
AGER; RAGE; SCARJ1
Purity
>90% by SDS-PAGE.
Synonyms
AGER/RAGE; Recombinant Human AGER/RAGE Protein; RAGE; AGER/RAGE active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA
Sequence Length
347
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Recombinant Human AGER / RAGE Fc Chimera immobilized at 5 ug/mL (100 uL/well) on a goat anti-human IgG Fc antibody-coated plate (0.5 ug/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin with a linear range of 0.02-1 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human AGER/RAGE Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 100 kDa.)

SDS-Page (Recombinant Human AGER/RAGE Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 100 kDa.)
Related Product Information for AGER/RAGE active protein
Description: Recombinant Human AGER/RAGE Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln24-Ala344) of human AGER/RAGE (Accession #NP_001127.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: Receptor for Advanced Glycosylation End Products (RAGE, or AGER) is a member of the immunoglobulin super-family transmembrane proteins, as a signal transduction receptor which binds advanced glycation endproducts, certain members of the S100/calgranulin family of proteins, high mobility group box 1 (HMGB1), advanced oxidation protein products, and amyloid (beta-sheet fibrils). It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as atherosclerosis, arthritis, Alzheimer's disease, atherosclerosis and aging associated diseases.
Product Categories/Family for AGER/RAGE active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
177
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
advanced glycosylation end product-specific receptor isoform 6
NCBI Official Synonym Full Names
advanced glycosylation end-product specific receptor
NCBI Official Symbol
AGER
NCBI Official Synonym Symbols
RAGE; SCARJ1
NCBI Protein Information
advanced glycosylation end product-specific receptor
UniProt Protein Name
Advanced glycosylation end product-specific receptor
UniProt Gene Name
AGER
UniProt Synonym Gene Names
RAGE
UniProt Entry Name
RAGE_HUMAN

NCBI Description

The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]

Uniprot Description

RAGE: Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF- alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Interacts with S100B, S100A1 and APP. Interacts with S100A12. Endothelial cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Motility/polarity/chemotaxis; Cell cycle regulation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: identical protein binding; protein binding; transmembrane receptor activity; receptor activity

Biological Process: cell surface receptor linked signal transduction; response to wounding; innate immune response; inflammatory response; neurite development; induction of positive chemotaxis; activation of NF-kappaB transcription factor

Research Articles on AGER/RAGE

Similar Products

Product Notes

The AGER/RAGE ager (Catalog #AAA9141732) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QNITARIGEP LVLKCKGAPK KPPQRLEWKL NTGRTEAWKV LSPQGGGPWD SVARVLPNGS LFLPAVGIQD EGIFRCQAMN RNGKETKSNY RVRVYQIPGK PEIVDSASEL TAGVPNKVGT CVSEGSYPAG TLSWHLDGKP LVPNEKGVSV KEQTRRHPET GLFTLQSELM VTPARGGDPR PTFSCSFSPG LPRHRALRTA PIQPRVWEPV PLEEVQLVVE PEGGAVAPGG TVTLTCEVPA QPSPQIHWMK DGVPLPLPPS PVLILPEIGP QDQGTYSCVA THSSHGPQES RAVSISIIEP GEEGPTAGSV GGSGLGTLAL A. It is sometimes possible for the material contained within the vial of "AGER/RAGE, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.