Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ITGB6 Polyclonal Antibody)

Rabbit ITGB6 Polyclonal Antibody | anti-ITGB6 antibody

ITGB6 Polyclonal Antibody

Gene Names
ITGB6; AI1H
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ITGB6; Polyclonal Antibody; ITGB6 Polyclonal Antibody; AI1H; integrin beta-6; anti-ITGB6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.25 mg/ml (varies by lot)
Sequence Length
788
Applicable Applications for anti-ITGB6 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 732-788 of human ITGB6 (NP_000879.2).
Immunogen Sequence
LLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ITGB6 Polyclonal Antibody)

Western Blot (WB) (Western blot-ITGB6 Polyclonal Antibody)
Related Product Information for anti-ITGB6 antibody
This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms a dimer with an alpha v chain and this heterodimer can bind to ligands like fibronectin and transforming growth factor beta 1. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa; 85kDa
NCBI Official Full Name
integrin beta-6 isoform a
NCBI Official Synonym Full Names
integrin subunit beta 6
NCBI Official Symbol
ITGB6
NCBI Official Synonym Symbols
AI1H
NCBI Protein Information
integrin beta-6
UniProt Protein Name
Integrin beta-6
Protein Family
UniProt Gene Name
ITGB6
UniProt Entry Name
ITB6_HUMAN

NCBI Description

This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms a dimer with an alpha v chain and this heterodimer can bind to ligands like fibronectin and transforming growth factor beta 1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

ITGB6: Integrin alpha-V/beta-6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion. Belongs to the integrin beta chain family.

Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q24.2

Cellular Component: plasma membrane; integrin complex; receptor complex; external side of plasma membrane

Molecular Function: viral receptor activity; integrin binding

Biological Process: integrin-mediated signaling pathway; entry of virus into host cell; extracellular matrix organization and biogenesis; multicellular organismal development; cell-matrix adhesion; inflammatory response; cell adhesion

Disease: Amelogenesis Imperfecta, Type Ih

Research Articles on ITGB6

Similar Products

Product Notes

The ITGB6 itgb6 (Catalog #AAA9141003) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB6 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ITGB6 itgb6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGB6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.