Rabbit anti-Mouse, Rat FGD1 Polyclonal Antibody | anti-FGD1 antibody

FGD1 Polyclonal Antibody

Cat. Num. AAA9140973

• Gene Names: FGD1; AAS; FGDY; MRXS16; ZFYVE3
• Reactivity: Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: FGD1; Polyclonal Antibody; FGD1 Polyclonal Antibody; AAS; FGDY; MRXS16; ZFYVE3; FYVE; RhoGEF and PH domain containing 1; anti-FGD1 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.77 mg/ml (varies by lot)
• Sequence Length: 961

• Applicable Applications for anti-FGD1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2).
• Immunogen Sequence: LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS
• Positive Samples: Mouse Brain, Mouse Heart, Rat Brain
• Cellular Location: Cell Projection, Cytoplasm, Cytoskeleton, Lamellipodium, Ruffle
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-FGD1 Polyclonal Antibody)

Related Product Information for anti-FGD1 antibody

This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16.

NCBI and Uniprot Product Information

• NCBI GI #: 24797153
• NCBI GeneID: 2245
• NCBI Accession #: NP_004454.2
• NCBI GenBank Nucleotide #: NP_004454.2
• UniProt Accession #: P98174
• Molecular Weight: Calculated: 106kDa; Observed: 110kDa
• NCBI Official Full Name: FYVE, RhoGEF and PH domain-containing protein 1
• NCBI Official Synonym Full Names: FYVE, RhoGEF and PH domain containing 1
• NCBI Official Symbol: FGD1
• NCBI Official Synonym Symbols: AAS; FGDY; MRXS16; ZFYVE3
• NCBI Protein Information: FYVE, RhoGEF and PH domain-containing protein 1
• UniProt Protein Name: FYVE, RhoGEF and PH domain-containing protein 1
• Protein Family: FYVE, RhoGEF and PH domain-containing protein
• UniProt Gene Name: FGD1
• UniProt Synonym Gene Names: FGDY; ZFYVE3; Rho/Rac GEF
• UniProt Entry Name: FGD1_HUMAN

NCBI Description

This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of the faciogenital dysplasia in Aarskog-Scott syndrome and a syndromatic form of X-linked cognitive disability. [provided by RefSeq, Jul 2017]