Rabbit anti-Human RFX1 Polyclonal Antibody | anti-RFX1 antibody

RFX1 Polyclonal Antibody

Cat. Num. AAA9140698

• Gene Names: RFX1; EFC; RFX
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: RFX1; Polyclonal Antibody; RFX1 Polyclonal Antibody; EFC; RFX; regulatory factor X1; anti-RFX1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.31 mg/ml (varies by lot)
• Sequence Length: 979

• Applicable Applications for anti-RFX1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RFX1 (NP_002909.4).
• Immunogen Sequence: QQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPHVYSSQVQYVEG
• Positive Samples: LO2
• Cellular Location: Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RFX1 Polyclonal Antibody)

Related Product Information for anti-RFX1 antibody

This gene encodes a member of the regulatory factor X (RFX) family of transcription factors, which are characterized by a winged-helix DNA-binding domain. The encoded transcription factor contains an N-terminal activation domain and a C-terminal repression domain, and may activate or repress target gene expression depending on cellular context. This transcription factor has been shown to regulate a wide variety of genes involved in immunity and cancer, including the MHC class II genes and genes that may be involved in cancer progression. This gene exhibits altered expression in glioblastoma and the autoimmune disease systemic lupus erythematosis (SLE).

NCBI and Uniprot Product Information

• NCBI GI #: 238859557
• NCBI GeneID: 5989
• NCBI Accession #: NP_002909
• NCBI GenBank Nucleotide #: NP_002909.4
• UniProt Accession #: P22670
• Molecular Weight: Calculated: 104kDa; Observed: 130kDa
• NCBI Official Full Name: MHC class II regulatory factor RFX1
• NCBI Official Synonym Full Names: regulatory factor X1
• NCBI Official Symbol: RFX1
• NCBI Official Synonym Symbols: EFC; RFX
• NCBI Protein Information: MHC class II regulatory factor RFX1
• UniProt Protein Name: MHC class II regulatory factor RFX1
• Protein Family: RFX-like DNA-binding protein
• UniProt Gene Name: RFX1
• UniProt Synonym Gene Names: EF-C; RFX
• UniProt Entry Name: RFX1_HUMAN

NCBI Description

This gene encodes a member of the regulatory factor X (RFX) family of transcription factors, which are characterized by a winged-helix DNA-binding domain. The encoded transcription factor contains an N-terminal activation domain and a C-terminal repression domain, and may activate or repress target gene expression depending on cellular context. This transcription factor has been shown to regulate a wide variety of genes involved in immunity and cancer, including the MHC class II genes and genes that may be involved in cancer progression. This gene exhibits altered expression in glioblastoma and the autoimmune disease systemic lupus erythematosis (SLE). [provided by RefSeq, Jul 2016]

Uniprot Description

RFX1: Regulatory factor essential for MHC class II genes expression. Binds to the X boxes of MHC class II genes. Also binds to an inverted repeat (ENH1) required for hepatitis B virus genes expression and to the most upstream element (alpha) of the RPL30 promoter. Belongs to the RFX family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: intracellular membrane-bound organelle; nucleoplasm; nucleus

Molecular Function: protein binding; RNA polymerase II transcription factor activity, enhancer binding

Biological Process: immune response; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent