Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ATP10A Polyclonal Antibody)

Rabbit anti-Human ATP10A Polyclonal Antibody | anti-ATP10A antibody

ATP10A Polyclonal Antibody

Gene Names
ATP10A; ATPVA; ATPVC; ATP10C
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ATP10A; Polyclonal Antibody; ATP10A Polyclonal Antibody; ATP10C; ATPVA; ATPVC; probable phospholipid-transporting ATPase VA; anti-ATP10A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.09 mg/ml (varies by lot)
Sequence Length
1499
Applicable Applications for anti-ATP10A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ATP10A (NP_077816.1).
Immunogen Sequence
RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Positive Samples
A-549, U-251MG, DU-145, OVCAR3, HT-29, A-431
Cellular Location
Cell Membrane, Endoplasmic Reticulum Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ATP10A Polyclonal Antibody)

Western Blot (WB) (Western blot-ATP10A Polyclonal Antibody)
Related Product Information for anti-ATP10A antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 17kDa; 167kDa
Observed: 170kDa
NCBI Official Full Name
probable phospholipid-transporting ATPase VA
NCBI Official Synonym Full Names
ATPase phospholipid transporting 10A (putative)
NCBI Official Symbol
ATP10A
NCBI Official Synonym Symbols
ATPVA; ATPVC; ATP10C
NCBI Protein Information
probable phospholipid-transporting ATPase VA
UniProt Protein Name
Probable phospholipid-transporting ATPase VA
UniProt Gene Name
ATP10A
UniProt Synonym Gene Names
ATP10C; ATPVA; ATPVC; KIAA0566
UniProt Entry Name
AT10A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'. [provided by RefSeq, Jul 2008]

Research Articles on ATP10A

Similar Products

Product Notes

The ATP10A atp10a (Catalog #AAA9140575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP10A Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP10A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ATP10A atp10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP10A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.