Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-NHLH1 Polyclonal Antibody)

Rabbit anti-Human NHLH1 Polyclonal Antibody | anti-NHLH1 antibody

NHLH1 Polyclonal Antibody

Gene Names
NHLH1; HEN1; NSCL; NSCL1; bHLHa35
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NHLH1; Polyclonal Antibody; NHLH1 Polyclonal Antibody; HEN1; NSCL; NSCL1; bHLHa35; helix-loop-helix protein 1; anti-NHLH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.73 mg/ml (varies by lot)
Sequence Length
133
Applicable Applications for anti-NHLH1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1).
Immunogen Sequence
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
Positive Samples
U-87MG
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-NHLH1 Polyclonal Antibody)

Western Blot (WB) (Western blot-NHLH1 Polyclonal Antibody)
Related Product Information for anti-NHLH1 antibody
The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 14kDa
Observed: 15kDa
NCBI Official Full Name
helix-loop-helix protein 1
NCBI Official Synonym Full Names
nescient helix-loop-helix 1
NCBI Official Symbol
NHLH1
NCBI Official Synonym Symbols
HEN1; NSCL; NSCL1; bHLHa35
NCBI Protein Information
helix-loop-helix protein 1
UniProt Protein Name
Helix-loop-helix protein 1
Protein Family
UniProt Gene Name
NHLH1
UniProt Synonym Gene Names
BHLHA35; HEN1; HEN-1; bHLHa35; NSCL-1
UniProt Entry Name
HEN1_HUMAN

NCBI Description

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM, Nov 2002]

Uniprot Description

NHLH1: May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: nucleus

Molecular Function: protein dimerization activity

Biological Process: central nervous system development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on NHLH1

Similar Products

Product Notes

The NHLH1 nhlh1 (Catalog #AAA9140431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NHLH1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NHLH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NHLH1 nhlh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NHLH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.