SDS-Page
(Recombinant Mouse CD155/PVR Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
CD155/PVR Recombinant Protein | PVR recombinant protein
Recombinant Mouse CD155/PVR Protein
Gene Names
Pvr; PVS; mE4; HVED; Taa1; CD155; Tage4; necl-5; D7Ertd458e; 3830421F03Rik
Purity
>95% by SDS-PAGE.
Synonyms
CD155/PVR; Recombinant Mouse CD155/PVR Protein; Poliovirus receptor; CD155 antigen; Nectin-like protein 5; Nectin-2; Tage4 receptor; Pvr; PVR; Necl5; CD155; PVR recombinant protein
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWS
Sequence Length
408
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Mouse CD155/PVR Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
SDS-Page
(Recombinant Mouse CD155/PVR Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for PVR recombinant protein
Description: Recombinant Mouse CD155/PVR Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Asp29-Leu348) of mouse CD155/PVR (Accession #Q8K094) fused with a 6xHis tag at the C-terminus.
Background: Mouse poliovirus receptor (PVR, CD155) is a type I transmembrane (TM) glycoprotein that is a member of thenectin-related family of adhesion proteins within the immunoglobulin superfamily. It binds other moleculesincluding vitronectin, Nectin3, DNAM1, CD96, and TIGIT, but does not bind homotypically. CD155 includes a 28aa signal sequence, a 318 aa extracellular domain (ECD) with one N-terminal V-type and two C2-type Ig-likedomains, a 24 aa TM segment and a 38 aa cytoplasmic tail. Epithelial, endothelial, and many immune cellsshow low CD155 expression. It is up-regulated on endothelia by IFN gamma, and is highly expressed on immaturethymocytes, lymph node dendritic cells, and tumor cells of epithelial and neuronal origin. On migrating cells, itis concentrated at the leading edge, where it binds basement membrane vitronectin, recruits Nectin-3-expressing cells, and cooperates with PDGF and integrin alphavbeta3 to promote cell migration. Binding of monocyteDNAM-1 to endothelial cell CD155 promotes transendothelial migration. Enhanced CD155 expression in tumorcells contributes to loss of contact inhibition and increased migration, but also allows tumor cell recognitionand killing by DNAM-1or CD96 expressing NK cells.
Background: Mouse poliovirus receptor (PVR, CD155) is a type I transmembrane (TM) glycoprotein that is a member of thenectin-related family of adhesion proteins within the immunoglobulin superfamily. It binds other moleculesincluding vitronectin, Nectin3, DNAM1, CD96, and TIGIT, but does not bind homotypically. CD155 includes a 28aa signal sequence, a 318 aa extracellular domain (ECD) with one N-terminal V-type and two C2-type Ig-likedomains, a 24 aa TM segment and a 38 aa cytoplasmic tail. Epithelial, endothelial, and many immune cellsshow low CD155 expression. It is up-regulated on endothelia by IFN gamma, and is highly expressed on immaturethymocytes, lymph node dendritic cells, and tumor cells of epithelial and neuronal origin. On migrating cells, itis concentrated at the leading edge, where it binds basement membrane vitronectin, recruits Nectin-3-expressing cells, and cooperates with PDGF and integrin alphavbeta3 to promote cell migration. Binding of monocyteDNAM-1 to endothelial cell CD155 promotes transendothelial migration. Enhanced CD155 expression in tumorcells contributes to loss of contact inhibition and increased migration, but also allows tumor cell recognitionand killing by DNAM-1or CD96 expressing NK cells.
Product Categories/Family for PVR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
poliovirus receptor
NCBI Official Synonym Full Names
poliovirus receptor
NCBI Official Symbol
Pvr
NCBI Official Synonym Symbols
PVS; mE4; HVED; Taa1; CD155; Tage4; necl-5; D7Ertd458e; 3830421F03Rik
NCBI Protein Information
poliovirus receptor
UniProt Protein Name
Poliovirus receptor
Protein Family
UniProt Gene Name
Pvr
UniProt Synonym Gene Names
D7Ertd458e
UniProt Entry Name
Q8K094_MOUSE
Research Articles on PVR
Similar Products
Product Notes
The PVR pvr (Catalog #AAA9140184) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DIRVLVPYNS TGVLGGSTTL HCSLTSNENV TITQITWMKK DSGGSHALVA VFHPKKGPNI KEPERVKFLA AQQDLRNASL AISNLSVEDE GIYECQIATF PRGSRSTNAW LKVQARPKNT AEALEPSPTL ILQDVAKCIS ANGHPPGRIS WPSNVNGSHR EMKEPGSQPG TTTVTSYLSM VPSRQADGKN ITCTVEHESL QELDQLLVTL SQPYPPENVS ISGYDGNWYV GLTNLTLTCE AHSKPAPDMA GYNWS. It is sometimes possible for the material contained within the vial of "CD155/PVR, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
