Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-2RA/IL-2 R alpha/CD25 Recombinant Protein | IL-2RA recombinant protein

Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein

Gene Names
Il2ra; CD25; Il2r; Ly-43
Purity
>95% by SDS-PAGE.
Synonyms
IL-2RA/IL-2 R alpha/CD25; Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein; CD25; IL-2 R alpha; IL2RA; CD25 antigen; IDDM10; IL-2 receptor subunit alpha; IL2R; IL-2R subunitalpha; IL-2-RA; IL2-RA; interleukin 2 receptor; alpha; interleukin-2 receptor subunit alpha; p55; TAC antigen; TCGFR; IL-2RA recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Sequence Length
268
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-2RA recombinant protein
Description: Recombinant Mouse IL-2RA/IL-2 R alpha/CD25 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu22-Lys236) of mouse IL-2RA/IL-2 R alpha/CD25 (Accession #P01590) fused with a 6xHis tag at the C-terminus.

Background: The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents onactivated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is amember of cytokine receptors family that utilizes the common gamma chain subunit (gammac). IL2RA is expressed inmost B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltratinglymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinityreceptor for IL-2.
Product Categories/Family for IL-2RA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Interleukin-2 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 2 receptor, alpha chain
NCBI Official Symbol
Il2ra
NCBI Official Synonym Symbols
CD25; Il2r; Ly-43
NCBI Protein Information
interleukin-2 receptor subunit alpha
UniProt Protein Name
Interleukin-2 receptor subunit alpha
UniProt Gene Name
Il2ra
UniProt Synonym Gene Names
Il2r; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA
UniProt Entry Name
IL2RA_MOUSE

Uniprot Description

IL2RA: Receptor for interleukin-2. Non-covalent dimer of an alpha and a beta subunit. IL2R exists in 3 different forms: a high affinity dimer, an intermediate affinity monomer (beta subunit), and a low affinity monomer (alpha subunit). The high and intermediate affinity forms also associate with a gamma subunit.

Protein type: Membrane protein, integral

Cellular Component: cell surface; membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; interleukin-2 receptor activity; drug binding; interleukin-2 binding

Biological Process: Notch signaling pathway; regulation of T cell homeostatic proliferation; negative regulation of immune response; negative regulation of defense response to virus; positive regulation of activated T cell proliferation; negative regulation of lymphocyte proliferation; inflammatory response to antigenic stimulus; negative regulation of T cell proliferation; positive regulation of T cell differentiation; negative regulation of inflammatory response; T cell homeostasis; positive regulation of T cell proliferation; immune response; activated T cell apoptosis

Research Articles on IL-2RA

Similar Products

Product Notes

The IL-2RA il2ra (Catalog #AAA9140113) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ELCLYDPPEV PNATFKALSY KNGTILNCEC KRGFRRLKEL VYMRCLGNSW SSNCQCTSNS HDKSRKQVTA QLEHQKEQQT TTDMQKPTQS MHQENLTGHC REPPPWKHED SKRIYHFVEG QSVHYECIPG YKALQRGPAI SICKMKCGKT GWTQPQLTCV DEREHHRFLA SEESQGSRNS SPESETSCPI TTTDFPQPTE TTAMTETFVL TMEYK. It is sometimes possible for the material contained within the vial of "IL-2RA/IL-2 R alpha/CD25, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.