Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human S100A8/Protein S100-A8 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 18 kDa and 21 kDa.)

S100A8/Protein S100-A8 Active Protein | S100A8 active protein

Recombinant Human S100A8/Protein S100-A8 Protein

Gene Names
S100A8; P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
Purity
>95% by SDS-PAGE.
Synonyms
S100A8/Protein S100-A8; Recombinant Human S100A8/Protein S100-A8 Protein; 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8; S100A8 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.
Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Sequence Length
93
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 4-20 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human S100A8/Protein S100-A8 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 18 kDa and 21 kDa.)

SDS-Page (Recombinant protein Human S100A8/Protein S100-A8 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 18 kDa and 21 kDa.)
Related Product Information for S100A8 active protein
Description: Recombinant Human S100A8/Protein S100-A8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu93) of human S100A8/Protein S100-A8 (Accession #P05109) fused with a 6xHis tag at the C-terminus.

Background: This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for S100A8 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
S100A8, partial
NCBI Official Synonym Full Names
S100 calcium binding protein A8
NCBI Official Symbol
S100A8
NCBI Official Synonym Symbols
P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
NCBI Protein Information
protein S100-A8
UniProt Protein Name
Protein S100-A8
Protein Family
UniProt Gene Name
S100A8
UniProt Synonym Gene Names
CAGA; CFAG; MRP8; CFAG; MRP-8; p8
UniProt Entry Name
S10A8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

S100A8: S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH- oxidase by facilitating the enzyme complex assembly at the cell membrane, transfering arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF- kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; cytoskeleton; plasma membrane; extracellular region; nucleus; cytosol

Molecular Function: arachidonic acid binding; RAGE receptor binding; protein binding; zinc ion binding; microtubule binding; calcium ion binding

Biological Process: caspase activation; neutrophil chemotaxis; chronic inflammatory response; chemokine production; wound healing; cytokine production; positive regulation of peptide secretion; response to lipopolysaccharide; positive regulation of cell growth; leukocyte migration during inflammatory response; activation of NF-kappaB transcription factor; sequestering of zinc ion; response to ethanol; response to zinc ion; defense response to bacterium; autophagy; innate immune response; inflammatory response; defense response to fungus; acute inflammatory response; regulation of cytoskeleton organization and biogenesis; positive regulation of inflammatory response

Research Articles on S100A8

Similar Products

Product Notes

The S100A8 s100a8 (Catalog #AAA9139873) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLTELEKALN SIIDVYHKYS LIKGNFHAVY RDDLKKLLET ECPQYIRKKG ADVWFKELDI NTDGAVNFQE FLILVIKMGV AAHKKSHEES HKE. It is sometimes possible for the material contained within the vial of "S100A8/Protein S100-A8, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.