Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human NKRF Monoclonal Antibody | anti-NKRF antibody

NKRF (NF-kappa-B-repressing Factor, NFkB-repressing Factor, Transcription Factor NRF, ITBA4 Protein, NRF, ITBA4) (FITC)

Gene Names
NKRF; NRF; ITBA4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NKRF; Monoclonal Antibody; NKRF (NF-kappa-B-repressing Factor; NFkB-repressing Factor; Transcription Factor NRF; ITBA4 Protein; NRF; ITBA4) (FITC); anti-NKRF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F6
Specificity
Recognizes human NKRF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NKRF antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa591-691 from human NKRF (NP_060014) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of NKRF expression in transfected 293T cell line by NKRF monoclonal antibody. Lane 1: NKRF transfected lysate (77.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NKRF expression in transfected 293T cell line by NKRF monoclonal antibody. Lane 1: NKRF transfected lysate (77.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NKRF is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NKRF is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-NKRF antibody
NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.
Product Categories/Family for anti-NKRF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,673 Da
NCBI Official Full Name
NF-kappa-B-repressing factor isoform 2
NCBI Official Synonym Full Names
NFKB repressing factor
NCBI Official Symbol
NKRF
NCBI Official Synonym Symbols
NRF; ITBA4
NCBI Protein Information
NF-kappa-B-repressing factor; transcription factor NRF
UniProt Protein Name
NF-kappa-B-repressing factor
UniProt Gene Name
NKRF
UniProt Synonym Gene Names
ITBA4; NRF; NFkB-repressing factor
UniProt Entry Name
NKRF_HUMAN

NCBI Description

This gene encodes a transcriptional repressor that interacts with specific negative regulatory elements to mediate transcriptional repression of certain nuclear factor kappa B responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

NKRF: Interacts with a specific negative regulatory element (NRE) 5'-AATTCCTCTGA-3' to mediate transcriptional repression of certain NK-kappa-B responsive genes. Involved in the constitutive silencing of the interferon beta promoter, independently of the virus-induced signals, and in the inhibition of the basal and cytokine-induced iNOS promoter activity. Also involved in the regulation of IL-8 transcription.

Protein type: RNA-binding; Transcription, coactivator/corepressor; Nucleolus

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: endoplasmic reticulum; nucleolus; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Research Articles on NKRF

Similar Products

Product Notes

The NKRF nkrf (Catalog #AAA6148496) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NKRF (NF-kappa-B-repressing Factor, NFkB-repressing Factor, Transcription Factor NRF, ITBA4 Protein, NRF, ITBA4) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NKRF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NKRF nkrf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NKRF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.