Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD30/TNFRSF8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-85 kDa.)

CD30/TNFRSF8 Active Protein | TNFRSF8 active protein

Recombinant Human CD30/TNFRSF8 Protein

Gene Names
TNFRSF8; CD30; Ki-1; D1S166E
Purity
>97% by SDS-PAGE.
Synonyms
CD30/TNFRSF8; Recombinant Human CD30/TNFRSF8 Protein; CD30; D1S166E; Ki-1; TNFRSF8 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Sequence Length
595
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to block CD30 Ligand-induced IL-6 secretion by HDLM human Hodgkin's lymphoma cells. The ED50 for this effect is 1-5 ug/mL in the presence of 50 ng/mL of Recombinant Human CD30 Ligand.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD30/TNFRSF8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-85 kDa.)

SDS-Page (Recombinant Human CD30/TNFRSF8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-85 kDa.)
Related Product Information for TNFRSF8 active protein
Description: Recombinant Human CD30/TNFRSF8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of human CD30/TNFRSF8 (Accession #NP_001234.2) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Product Categories/Family for TNFRSF8 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
943
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 8 isoform 1
NCBI Official Synonym Full Names
TNF receptor superfamily member 8
NCBI Official Symbol
TNFRSF8
NCBI Official Synonym Symbols
CD30; Ki-1; D1S166E
NCBI Protein Information
tumor necrosis factor receptor superfamily member 8
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 8
UniProt Gene Name
TNFRSF8
UniProt Synonym Gene Names
CD30; D1S166E
UniProt Entry Name
TNR8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF8: Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF- kappa-B. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity; tumor necrosis factor receptor activity

Biological Process: immune response; inflammatory response; multicellular organismal development; negative regulation of cell proliferation; positive regulation of apoptosis; positive regulation of TRAIL biosynthetic process; positive regulation of tumor necrosis factor biosynthetic process; response to lipopolysaccharide; signal transduction

Research Articles on TNFRSF8

Similar Products

Product Notes

The TNFRSF8 tnfrsf8 (Catalog #AAA9139703) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FPQDRPFEDT CHGNPSHYYD KAVRRCCYRC PMGLFPTQQC PQRPTDCRKQ CEPDYYLDEA DRCTACVTCS RDDLVEKTPC AWNSSRVCEC RPGMFCSTSA VNSCARCFFH SVCPAGMIVK FPGTAQKNTV CEPASPGVSP ACASPENCKE PSSGTIPQAK PTPVSPATSS ASTMPVRGGT RLAQEAASKL TRAPDSPSSV GRPSSDPGLS PTQPCPEGSG DCRKQCEPDY YLDEAGRCTA CVSCSRDDLV EKTPCAWNSS RTCECRPGMI CATSATNSCA RCVPYPICAA ETVTKPQDMA EKDTTFEAPP LGTQPDCNPT PENGEAPAST SPTQSLLVDS QASKTLPIPT SAPVALSSTG K. It is sometimes possible for the material contained within the vial of "CD30/TNFRSF8, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.