Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Fc gamma RIIB/C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)

Fc gamma RIIB/C Active Protein | FCGR2B active protein

Recombinant Human Fc gamma RIIB/C Protein

Gene Names
FCGR2B; CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcRII-c
Purity
>97% by SDS-PAGE.
Synonyms
Fc gamma RIIB/C; Recombinant Human Fc gamma RIIB/C Protein; CD32; CD32B; FCG2; FCGR2; IGFR2; FCGR2B active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Sequence Length
290
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human CD32b at 10 ug/ml (100 ul/well) can bind human IgG2 with a linear range of 0.16-6.4 ug/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Fc gamma RIIB/C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)

SDS-Page (Recombinant Human Fc gamma RIIB/C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)
Related Product Information for FCGR2B active protein
Description: Recombinant Human Fc gamma RIIB/C Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala46-Pro217) of human Fc gamma RIIB/C (Accession #NP_003992.3) fused with a 6xHis tag at the C-terminus.

Background: The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.
Product Categories/Family for FCGR2B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-b isoform 2
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIb
NCBI Official Symbol
FCGR2B
NCBI Official Synonym Symbols
CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcRII-c
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-b
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-b
UniProt Gene Name
FCGR2B
UniProt Synonym Gene Names
CD32; FCG2; IGFR2; IgG Fc receptor II-b; Fc-gamma-RIIb; FcRII-b
UniProt Entry Name
FCG2B_HUMAN

NCBI Description

The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

FCGR2B: a transmembrane receptor for the Fc region of complexed or aggregated immunoglobulin gamma (IgG). Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down modulation of previous state of cell activation triggered via antigen receptors on B cells, T cells or via another Fc receptor. Three splice-variant isoforms have been observed.

Protein type: Membrane protein, integral; Cell surface; Oncoprotein

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; IgG binding

Biological Process: regulation of immune response; viral reproduction; immune response; signal transduction

Disease: Systemic Lupus Erythematosus; Malaria, Susceptibility To

Research Articles on FCGR2B

Similar Products

Product Notes

The FCGR2B fcgr2b (Catalog #AAA9139675) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APPKAVLKLE PQWINVLQED SVTLTCRGTH SPESDSIQWF HNGNLIPTHT QPSYRFKANN NDSGEYTCQT GQTSLSDPVH LTVLSEWLVL QTPHLEFQEG ETIVLRCHSW KDKPLVKVTF FQNGKSKKFS RSDPNFSIPQ ANHSHSGDYH CTGNIGYTLY SSKPVTITVQ AP. It is sometimes possible for the material contained within the vial of "Fc gamma RIIB/C, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.