Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Fc gamma RIIA/CD32a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32-38 kDa.)

Fc gamma RIIA/CD32a Active Protein | FCGR2A active protein

Recombinant Human Fc gamma RIIA/CD32a Protein

Gene Names
FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
Purity
>97% by SDS-PAGE.
Synonyms
Fc gamma RIIA/CD32a; Recombinant Human Fc gamma RIIA/CD32a Protein; CD32; CD32A; CDw32; FCG2; FcGR; FCGR2; FCGR2A1; IGFR2; FCGR2A active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Sequence Length
317
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human CD32a at 1 ug/mL (100 uL/well) can bind biotinylated human IgG1 with a linear range of 30-250 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Fc gamma RIIA/CD32a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32-38 kDa.)

SDS-Page (Recombinant Human Fc gamma RIIA/CD32a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32-38 kDa.)
Related Product Information for FCGR2A active protein
Description: Recombinant Human Fc gamma RIIA/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218 (R167)) of human Fc gamma RIIA/CD32a (Accession #NP_001129691.1) fused with a 6xHis tag at the C-terminus.

Background: The member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Product Categories/Family for FCGR2A active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-a isoform 1
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIa
NCBI Official Symbol
FCGR2A
NCBI Official Synonym Symbols
CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Gene Name
FCGR2A
UniProt Synonym Gene Names
CD32; FCG2; FCGR2A1; IGFR2; IgG Fc receptor II-a; Fc-gamma-RIIa; FcRII-a
UniProt Entry Name
FCG2A_HUMAN

NCBI Description

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]

Uniprot Description

FCGR2A: low affinity receptor for the Fc region of IgGs. Binding to IgG initiates cellular responses against pathogens and soluble antigens. A type I membrane protein found on monocytes, neutrophils and platelets. SHP-1 associates with this protein to modulate signaling events in myeloid cells.

Protein type: Cell surface; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: plasma membrane; integral to membrane

Molecular Function: IgG binding

Biological Process: innate immune response

Disease: Systemic Lupus Erythematosus; Malaria, Susceptibility To

Research Articles on FCGR2A

Similar Products

Product Notes

The FCGR2A fcgr2a (Catalog #AAA9139680) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AAPPKAVLKL EPPWINVLQE DSVTLTCQGA RSPESDSIQW FHNGNLIPTH TQPSYRFKAN NNDSGEYTCQ TGQTSLSDPV HLTVLSEWLV LQTPHLEFQE GETIMLRCHS WKDKPLVKVT FFQNGKSQKF SHLDPTFSIP QANHSHSGDY HCTGNIGYTL FSSKPVTITV QVPSMGSSSP MGI. It is sometimes possible for the material contained within the vial of "Fc gamma RIIA/CD32a, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.