Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human R-Spondin1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 39 kDa.)

R-Spondin1 Active Protein | RSPO active protein

Recombinant Human R-Spondin1 Protein

Gene Names
RSPO1; RSPO; CRISTIN3
Purity
>92% by SDS-PAGE.
Synonyms
R-Spondin1; Recombinant Human R-Spondin1 Protein; CRISTIN3; RSPO active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Sequence Length
263
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to enhance Cyclin D1 expression in HCT116 human colon adenocarcinoma cells.0.1-10ng/mL of Recombinant Human RSPO1 can effectively enhance Cyclin D1 expression.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human R-Spondin1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 39 kDa.)

SDS-Page (Recombinant Human R-Spondin1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 39 kDa.)
Related Product Information for RSPO active protein
Description: Recombinant Human R-Spondin1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6xHis tag at the C-terminus.

Background: This protein is a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects.
Product Categories/Family for RSPO active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
R-spondin-1 isoform 1
NCBI Official Synonym Full Names
R-spondin 1
NCBI Official Symbol
RSPO1
NCBI Official Synonym Symbols
RSPO; CRISTIN3
NCBI Protein Information
R-spondin-1
UniProt Protein Name
R-spondin-1
UniProt Gene Name
RSPO1
UniProt Synonym Gene Names
hRspo1
UniProt Entry Name
RSPO1_HUMAN

NCBI Description

This gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

R-spondin-1: Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway and in non-canonical Wnt signaling pathway, probably by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Defects in RSPO1 are the cause of palmoplantar keratoderma with squamous cell carcinoma of skin and sex reversal (PKKSCC). This recessive syndrome is characterized by XX (female to male) SRY-independent sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. Belongs to the R-spondin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Cell development/differentiation; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: extracellular space; extracellular region; nucleus

Molecular Function: heparin binding; protein binding; G-protein-coupled receptor binding; receptor binding

Biological Process: regulation of gene expression; regulation of receptor internalization; Wnt receptor signaling pathway through beta-catenin; positive regulation of protein amino acid phosphorylation; male meiosis; positive regulation of Wnt receptor signaling pathway

Disease: Palmoplantar Hyperkeratosis With Squamous Cell Carcinoma Of Skin And 46,xx Sex Reversal

Research Articles on RSPO

Similar Products

Product Notes

The RSPO rspo1 (Catalog #AAA9139673) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RISAEGSQAC AKGCELCSEV NGCLKCSPKL FILLERNDIR QVGVCLPSCP PGYFDARNPD MNKCIKCKIE HCEACFSHNF CTKCKEGLYL HKGRCYPACP EGSSAANGTM ECSSPAQCEM SEWSPWGPCS KKQQLCGFRR GSEERTRRVL HAPVGDHAAC SDTKETRRCT VRRVPCPEGQ KRRKGGQGRR ENANRNLARK ESKEAGAGSR RRKGQQQQQQ QGTVGPLTSA GPA. It is sometimes possible for the material contained within the vial of "R-Spondin1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.