Rabbit anti-Human SEC23IP Polyclonal Antibody | anti-SEC23IP antibody
SEC23IP Polyclonal Antibody
Gene Names
SEC23IP; P125; P125A; MSTP053
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SEC23IP; Polyclonal Antibody; SEC23IP Polyclonal Antibody; MSTP053; P125; P125A; anti-SEC23IP antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
NLSKCPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKR
Sequence Length
1000
Applicable Applications for anti-SEC23IP antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human SEC23IP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
COPII-coated vesicle membrane, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-SEC23IP antibody
This gene encodes a member of the phosphatidic acid preferring-phospholipase A1 family. The encoded protein is localized to endoplasmic reticulum exit sites and plays a critical role in ER-Golgi transport as part of the multimeric coat protein II complex. An orthologous gene in frogs is required for normal neural crest cell development, suggesting that this gene may play a role in Waardenburg syndrome neural crest defects. Alternatively spliced transcript variants have been observed for this gene.
Product Categories/Family for anti-SEC23IP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
102kDa/111kDa
NCBI Official Full Name
SEC23-interacting protein
NCBI Official Synonym Full Names
SEC23 interacting protein
NCBI Official Symbol
SEC23IP
NCBI Official Synonym Symbols
P125; P125A; MSTP053
NCBI Protein Information
SEC23-interacting protein
UniProt Protein Name
SEC23-interacting protein
Protein Family
UniProt Gene Name
SEC23IP
NCBI Description
This gene encodes a member of the phosphatidic acid preferring-phospholipase A1 family. The encoded protein is localized to endoplasmic reticulum exit sites and plays a critical role in ER-Golgi transport as part of the multimeric coat protein II complex. An orthologous gene in frogs is required for normal neural crest cell development, suggesting that this gene may play a role in Waardenburg syndrome neural crest defects. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]
Uniprot Description
Plays a role in the organization of endoplasmic reticulum exit sites. Specifically binds to phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 4-phosphate (PI4P) and phosphatidylinositol 5-phosphate (PI5P).
Research Articles on SEC23IP
Similar Products
Product Notes
The SEC23IP sec23ip (Catalog #AAA9135384) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC23IP Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC23IP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the SEC23IP sec23ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLSKCPGPLA VANGVVKQLH FQEKQMPEEP KLTLDESYDL VVENKEVLTL QETLEALSLS EYFSTFEKEK IDMESLLMCT VDDLKEMGIP LGPRKKIANF VEHKAAKLKK AASEKKAVAA TSTKGQEQSA QKTKDMASLP SESNEPKRKL PVGACVSSVC VNYESFEVGA GQVSVAYNSL DFEPEIFFAL GSPIAMFLTI RGVDRIDENY SLPTCKGFFN IYHPLDPVAY RLEPMIVPDL DLKAVLIPHH KGRKR. It is sometimes possible for the material contained within the vial of "SEC23IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
