Rabbit anti-Human CNNM2 Polyclonal Antibody | anti-CNNM2 antibody
CNNM2 Polyclonal Antibody
Gene Names
CNNM2; ACDP2; HOMG6; HOMGSMR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CNNM2; Polyclonal Antibody; CNNM2 Polyclonal Antibody; ACDP2; HOMG6; HOMGSMR; anti-CNNM2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PLLLLSCCCGAGGCAAVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGERGLGGPAPPEPDSGPQRC
Sequence Length
875
Applicable Applications for anti-CNNM2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human CNNM2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-CNNM2 antibody
This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play an important role in magnesium homeostasis by mediating the epithelial transport and renal reabsorption of Mg2+. Mutations in this gene are associated with renal hypomagnesemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-CNNM2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60kDa/94kDa/96kDa
NCBI Official Full Name
metal transporter CNNM2 isoform 1
NCBI Official Synonym Full Names
cyclin and CBS domain divalent metal cation transport mediator 2
NCBI Official Symbol
CNNM2
NCBI Official Synonym Symbols
ACDP2; HOMG6; HOMGSMR
NCBI Protein Information
metal transporter CNNM2
UniProt Protein Name
Metal transporter CNNM2
Protein Family
UniProt Gene Name
CNNM2
UniProt Synonym Gene Names
ACDP2
NCBI Description
This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play an important role in magnesium homeostasis by mediating the epithelial transport and renal reabsorption of Mg2+. Mutations in this gene are associated with renal hypomagnesemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
Uniprot Description
Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+ ().
Research Articles on CNNM2
Similar Products
Product Notes
The CNNM2 cnnm2 (Catalog #AAA9135150) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNNM2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNNM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the CNNM2 cnnm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PLLLLSCCCG AGGCAAVGEN EETVIIGLRL EDTNDVSFME GGALRVSERT RVKLRVYGQN INNETWSRIA FTEHERRRHS PGERGLGGPA PPEPDSGPQR C. It is sometimes possible for the material contained within the vial of "CNNM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
