Western Blot (WB)
(Western blot analysis of extracts of rat kidney, using CORO1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Rat CORO1B Polyclonal Antibody | anti-CORO1B antibody
CORO1B Polyclonal Antibody
Gene Names
CORO1B; CORONIN-2
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CORO1B; Polyclonal Antibody; CORO1B Polyclonal Antibody; CORONIN-2; anti-CORO1B antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
Sequence Length
489
Applicable Applications for anti-CORO1B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human CORO1B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, cytoskeleton
Positive Samples
Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of rat kidney, using CORO1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of rat kidney, using CORO1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Product Categories/Family for anti-CORO1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 54kDa
Observed: 54kDa
Observed: 54kDa
NCBI Official Full Name
coronin-1B
NCBI Official Synonym Full Names
coronin 1B
NCBI Official Symbol
CORO1B
NCBI Official Synonym Symbols
CORONIN-2
NCBI Protein Information
coronin-1B
UniProt Protein Name
Coronin-1B
Protein Family
UniProt Gene Name
CORO1B
NCBI Description
Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008]
Uniprot Description
Regulates leading edge dynamics and cell motility in fibroblasts. May be involved in cytokinesis and signal transduction ().
Research Articles on CORO1B
Similar Products
Product Notes
The CORO1B coro1b (Catalog #AAA9134594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CORO1B Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CORO1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the CORO1B coro1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSGRDADPIL ISLREAYVPS KQRDLKISRR NVLSDSRPAM APGSSHLGAP ASTTTAADAT PSGSLARAGE AGKLEEVMQE LRALRALVKE QGDRICRLEE QLGRMENGDA. It is sometimes possible for the material contained within the vial of "CORO1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
