Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GOLIM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human, Mouse GOLIM4 Polyclonal Antibody | anti-GOLIM4 antibody
GOLIM4 Polyclonal Antibody
Gene Names
GOLIM4; P138; GIMPC; GOLPH4; GPP130
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GOLIM4; Polyclonal Antibody; GOLIM4 Polyclonal Antibody; GIMPC; GOLPH4; GPP130; P138; anti-GOLIM4 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHRKQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDV
Sequence Length
696
Applicable Applications for anti-GOLIM4 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human GOLIM4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endosome membrane, Golgi apparatus, Golgi stack membrane, Lipid-anchor, Membrane, Single-pass type II membrane protein
Positive Samples
HeLa, LO2
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GOLIM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GOLIM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-GOLIM4 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.
Product Categories/Family for anti-GOLIM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 81kDa
Observed: 130kDa
Observed: 130kDa
NCBI Official Full Name
Golgi integral membrane protein 4 isoform 1
NCBI Official Synonym Full Names
golgi integral membrane protein 4
NCBI Official Symbol
GOLIM4
NCBI Official Synonym Symbols
P138; GIMPC; GOLPH4; GPP130
NCBI Protein Information
Golgi integral membrane protein 4
UniProt Protein Name
Golgi integral membrane protein 4
Protein Family
UniProt Gene Name
GOLIM4
UniProt Synonym Gene Names
GIMPC; GOLPH4; GPP130; GIMPc; Golgi phosphoprotein of 130 kDa
NCBI Description
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq, Jul 2008]
Uniprot Description
Plays a role in endosome to Golgi protein trafficking; mediates protein transport along the late endosome-bypass pathway from the early endosome to the Golgi.
Research Articles on GOLIM4
Similar Products
Product Notes
The GOLIM4 golim4 (Catalog #AAA9134481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLIM4 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GOLIM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GOLIM4 golim4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YELQTQLRKA EAVALKYQQH QESLSAQLQV VYEHRSRLEK SLQKERLEHK KAKEDFLVYK LEAQETLNKG RQDSNSRYSA LNVQHQMLKS QHEELKKQHS DLEEEHRKQG EDFSRTFNDH KQKYLQLQQE KEQELSKLKE TVYNLREENR QLRKAHQDIH TQLQDVKQQH KNLLSEHEQL VVTLEDHKSA LAAAQTQVAE YKQLKDTLNR IPSLRKPDPA EQQNVTQVAH SPQGYNTARE KPTREVQEVS RNNDV. It is sometimes possible for the material contained within the vial of "GOLIM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
