Rabbit anti-Mouse, Rat RFTN2 Polyclonal Antibody | anti-RFTN2 antibody
RFTN2 Polyclonal Antibody
Gene Names
RFTN2; C2orf11; Raftlin-2
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RFTN2; Polyclonal Antibody; RFTN2 Polyclonal Antibody; C2orf11; Raftlin-2; anti-RFTN2 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCM
Sequence Length
501
Applicable Applications for anti-RFTN2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human RFTN2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Lipid-anchor
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-RFTN2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55kDa
NCBI Official Full Name
raftlin-2
NCBI Official Synonym Full Names
raftlin family member 2
NCBI Official Symbol
RFTN2
NCBI Official Synonym Symbols
C2orf11; Raftlin-2
NCBI Protein Information
raftlin-2
UniProt Protein Name
Raftlin-2
Protein Family
UniProt Gene Name
RFTN2
UniProt Synonym Gene Names
C2orf11
Uniprot Description
Upon bacterial lipopolysaccharide stimulation, mediates clathrin-dependent internalization of TLR4 in dendritic cells, resulting in activation of TICAM1-mediated signaling and subsequent IFNB1 production. May regulate B-cell antigen receptor-mediated signaling.
Similar Products
Product Notes
The RFTN2 rftn2 (Catalog #AAA9134448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RFTN2 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RFTN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RFTN2 rftn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KKASRHIKGE DKNKATSRSI GLDTTSSQPA ESRHLPEECR LSPSRECWTK EGRLAQHNSF SGFSSSDNVL RELDDGQFDQ EDGVTQVTCM. It is sometimes possible for the material contained within the vial of "RFTN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
