Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CX3CL1 Polyclonal Antibody | anti-CX3CL1 antibody

CX3CL1 Polyclonal Antibody

Gene Names
CX3CL1; NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CX3CL1; Polyclonal Antibody; CX3CL1 Polyclonal Antibody; ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1; anti-CX3CL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
Sequence Length
397
Applicable Applications for anti-CX3CL1 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human CX3CL1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Secreted, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-CX3CL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
fractalkine isoform 1
NCBI Official Synonym Full Names
C-X3-C motif chemokine ligand 1
NCBI Official Symbol
CX3CL1
NCBI Official Synonym Symbols
NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
NCBI Protein Information
fractalkine
UniProt Protein Name
Fractalkine
Protein Family
UniProt Gene Name
CX3CL1
UniProt Synonym Gene Names
FKN; NTT; SCYD1

NCBI Description

This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, resulting in a Cys-X-X-X-Cys configuration. The encoded protein contains an extended mucin-like stalk with a chemokine domain on top, and exists in both a membrane-anchored form where it acts as a binding molecule, or, in soluble form, as a chemotactic cytokine. The mature form of this protein can be cleaved at the cell surface, yielding different soluble forms that can interact with the G-protein coupled receptor, C-X3-C motif chemokine receptor 1 gene product. This gene plays a role in a wide range of diseases, including cancer, vasculitis, neuropathies, atherosclerosis, inflammatory diseases, and in human immunodeficiency virus infections. [provided by RefSeq, Sep 2017]

Uniprot Description

Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1 (PubMed:23125415, PubMed:9931005, PubMed:21829356). Binds to integrins ITGAV:ITGB3 and ITGA4:ITGB1. Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner. In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins. In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1 (PubMed:23125415, PubMed:24789099). The soluble form is chemotactic for T-cells and monocytes and not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium (PubMed:9024663, PubMed:9177350).

Research Articles on CX3CL1

Similar Products

Product Notes

The CX3CL1 cx3cl1 (Catalog #AAA9134208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CX3CL1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CX3CL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the CX3CL1 cx3cl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TSKIPVALLI HYQQNQASCG KRAIILETRQ HRLFCADPKE QWVKDAMQHL DRQAAALTRN GGTFEKQIGE VKPRTTPAAG GMDESVVLEP EATGESSSLE PTPSSQEAQR ALGTSPELPT GVTGSSGTRL PPTPKAQDGG P. It is sometimes possible for the material contained within the vial of "CX3CL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.