Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using STIP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Rabbit STIP1 Polyclonal Antibody | anti-STIP1 antibody
STIP1 Polyclonal Antibody
Gene Names
STIP1; HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
Reactivity
Human, Mouse, Monkey
Applications
Western Blot, Immunofluorescence, Immunoprecipitation
Purity
Affinity Purification
Synonyms
STIP1; Polyclonal Antibody; STIP1 Polyclonal Antibody; HEL-S-94n; HOP; IEF-SSP-3521; P60; STI1; STI1L; anti-STIP1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Monkey
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELD
Sequence Length
590
Applicable Applications for anti-STIP1 antibody
Western Blot (WB), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
IP: 1:20 - 1:50
IF: 1:50 - 1:200
IP: 1:20 - 1:50
Immunogen
Recombinant protein of human STIP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Positive Samples
HeLa, COS7, COS1, OVCAR3, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using STIP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using STIP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Product Categories/Family for anti-STIP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 59kDa; 62kDa; 68kDa
Observed: 69kDa
Observed: 69kDa
NCBI Official Full Name
stress-induced-phosphoprotein 1 isoform a
NCBI Official Synonym Full Names
stress induced phosphoprotein 1
NCBI Official Symbol
STIP1
NCBI Official Synonym Symbols
HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
NCBI Protein Information
stress-induced-phosphoprotein 1
UniProt Protein Name
Stress-induced-phosphoprotein 1
Protein Family
UniProt Gene Name
STIP1
UniProt Synonym Gene Names
STI1; Hop
NCBI Description
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009]
Uniprot Description
Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 ().
Research Articles on STIP1
Similar Products
Product Notes
The STIP1 stip1 (Catalog #AAA9134116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STIP1 Polyclonal Antibody reacts with Human, Mouse, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's STIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunoprecipitation (IP). WB: 1:500 - 1:2000 IF: 1:50 - 1:200 IP: 1:20 - 1:50. Researchers should empirically determine the suitability of the STIP1 stip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK AKELD. It is sometimes possible for the material contained within the vial of "STIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
