Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using KLK10 antibody at dilution of 1:100 (40x lens).)
Rabbit KLK10 Polyclonal Antibody | anti-KLK10 antibody
KLK10 Polyclonal Antibody
Gene Names
KLK10; NES1; PRSSL1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
KLK10; Polyclonal Antibody; KLK10 Polyclonal Antibody; NES1; PRSSL1; anti-KLK10 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Sequence Length
276
Applicable Applications for anti-KLK10 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 35-276 of human KLK10 (NP_001070968.1)
Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW
30kDa
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using KLK10 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using KLK10 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human prostate using KLK10 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human prostate using KLK10 antibody at dilution of 1:100 (40x lens).)
Immunofluorescence (IF)
(Immunofluorescence analysis of A549 cells using KLK10 antibody. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of A549 cells using KLK10 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-KLK10 antibody
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-KLK10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
kallikrein-10 preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 10
NCBI Official Symbol
KLK10
NCBI Official Synonym Symbols
NES1; PRSSL1
NCBI Protein Information
kallikrein-10
UniProt Protein Name
Kallikrein-10
Protein Family
UniProt Gene Name
KLK10
UniProt Synonym Gene Names
NES1; PRSSL1
NCBI Description
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Uniprot Description
Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Research Articles on KLK10
Similar Products
Product Notes
The KLK10 klk10 (Catalog #AAA9133660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLK10 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLK10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the KLK10 klk10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLPQNDTRLD PEAYGSPCAR GSQPWQVSLF NGLSFHCAGV LVDQSWVLTA AHCGNKPLWA RVGDDHLLLL QGEQLRRTTR SVVHPKYHQG SGPILPRRTD EHDLMLLKLA RPVVLGPRVR ALQLPYRCAQ PGDQCQVAGW GTTAARRVKY NKGLTCSSIT ILSPKECEVF YPGVVTNNMI CAGLDRGQDP CQSDSGGPLV CDETLQGILS WGVYPCGSAQ HPAVYTQICK YMSWINKVIR SN. It is sometimes possible for the material contained within the vial of "KLK10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
