Rabbit anti-Human, Mouse CREB3 Polyclonal Antibody | anti-CREB3 antibody

CREB3 Polyclonal Antibody

Cat. Num. AAA9133614

• Gene Names: CREB3; LZIP; LUMAN; sLZIP
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purification
• Synonyms: CREB3; Polyclonal Antibody; CREB3 Polyclonal Antibody; LUMAN; LZIP; sLZIP; anti-CREB3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTC
• Sequence Length: 371

• Applicable Applications for anti-CREB3 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: WB: 1:500 - 1:2000; IHC: 1:50 - 1:200
• Immunogen: Recombinant protein of human CREB3
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cytoplasm, Endoplasmic reticulum membrane, Membrane, Nucleus, Single-pass type II membrane protein
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of U-87MG cells, using CREB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse heart using CREB3 antibody at dilution of 1:100 (40x lens).)

Related Product Information for anti-CREB3 antibody

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.

Product Categories/Family for anti-CREB3 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 22219462
• NCBI GeneID: 10488
• NCBI Accession #: NP_006359.3
• NCBI GenBank Nucleotide #: NM_006368.4
• UniProt Accession #: O43889; O14671; O14919; Q5TCV1; Q96GK8; Q9H2W3; Q9UE77; D0PTW6
• Molecular Weight: Calculated: 39kDa; 41kDa; 43kDa; Observed: 48kDa
• NCBI Official Full Name: cyclic AMP-responsive element-binding protein 3
• NCBI Official Synonym Full Names: cAMP responsive element binding protein 3
• NCBI Official Symbol: CREB3
• NCBI Official Synonym Symbols: LZIP; LUMAN; sLZIP
• NCBI Protein Information: cyclic AMP-responsive element-binding protein 3
• UniProt Protein Name: Cyclic AMP-responsive element-binding protein 3
• Protein Family: CREB3 regulatory factor
• UniProt Gene Name: CREB3
• UniProt Synonym Gene Names: LZIP; CREB-3; cAMP-responsive element-binding protein 3; N-terminal Luman; Transcriptionally active form

NCBI Description

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.[provided by RefSeq, Nov 2009]

Uniprot Description

Endoplasmic reticulum (ER)-bound transcription factor that plays a role in the unfolded protein response (UPR). Involved in cell proliferation and migration, tumor suppression and inflammatory gene expression. Plays also a role in the human immunodeficiency virus type 1 (HIV-1) virus protein expression and in the herpes simplex virus-1 (HSV-1) latent infection and reactivation from latency. Isoform 2 plays a role in the unfolded protein response (UPR). Isoform 2 acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration. Isoform 2 may play a role as a cellular tumor suppressor that is targeted by the hepatitis C virus (HSV) core protein. Isoform 2 represses the VP16-mediated transactivation of immediate early genes of the HSV-1 virus by sequestring host cell factor-1 HCFC1 in the ER membrane of sensory neurons, thereby preventing the initiation of the replicative cascade leading to latent infection. Isoform 3 functions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Isoform 3 decreases the acetylation level of histone H4. Isoform 3 does not promote the chemotactic activity of leukocyte cells.