Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using CHD2 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human CHD2 Polyclonal Antibody | anti-CHD2 antibody

CHD2 Polyclonal Antibody

Gene Names
CHD2; EEOC
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
CHD2; Polyclonal Antibody; CHD2 Polyclonal Antibody; EEOC; anti-CHD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
SDDLIEMTGEGVDEQQDNSETIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKKFQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGENLELRDYQLEGLNWLA
Sequence Length
501
Applicable Applications for anti-CHD2 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human CHD2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using CHD2 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using CHD2 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CHD2 antibody
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-CHD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa/200kDa/211kDa
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 2 isoform 2
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 2
NCBI Official Symbol
CHD2
NCBI Official Synonym Symbols
EEOC
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 2
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 2
UniProt Gene Name
CHD2
UniProt Synonym Gene Names
CHD-2

NCBI Description

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DNA-binding helicase that specifically binds to the promoter of target genes, leading to chromatin remodeling, possibly by promoting deposition of histone H3.3. Involved in myogenesis via interaction with MYOD1: binds to myogenic gene regulatory sequences and mediates incorporation of histone H3.3 prior to the onset of myogenic gene expression, promoting their expression ().

Research Articles on CHD2

Similar Products

Product Notes

The CHD2 chd2 (Catalog #AAA9133516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHD2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the CHD2 chd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDDLIEMTGE GVDEQQDNSE TIEKVLDSRL GKKGATGAST TVYAIEANGD PSGDFDTEKD EGEIQYLIKW KGWSYIHSTW ESEESLQQQK VKGLKKLENF KKKEDEIKQW LGKVSPEDVE YFNCQQELAS ELNKQYQIVE RVIAVKTSKS TLGQTDFPAH SRKPAPSNEP EYLCKWMGLP YSECSWEDEA LIGKKFQNCI DSFHSRNNSK TIPTRECKAL KQRPRFVALK KQPAYLGGEN LELRDYQLEG LNWLA. It is sometimes possible for the material contained within the vial of "CHD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.