Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using NAT8B antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human NAT8B Polyclonal Antibody | anti-NAT8B antibody

NAT8B Polyclonal Antibody

Gene Names
NAT8B; CML2; Hcml2; NAT8BP
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
NAT8B; Polyclonal Antibody; NAT8B Polyclonal Antibody; anti-NAT8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA
Sequence Length
227
Applicable Applications for anti-NAT8B antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human NAT8B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type II membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using NAT8B antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using NAT8B antibody. Blue: DAPI for nuclear staining.)
Product Categories/Family for anti-NAT8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
putative N-acetyltransferase 8B
NCBI Official Synonym Full Names
N-acetyltransferase 8B (putative, gene/pseudogene)
NCBI Official Symbol
NAT8B
NCBI Official Synonym Symbols
CML2; Hcml2; NAT8BP
NCBI Protein Information
putative N-acetyltransferase 8B
UniProt Protein Name
Putative N-acetyltransferase 8B
UniProt Gene Name
NAT8B
UniProt Synonym Gene Names
ATase1

NCBI Description

The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008]

Uniprot Description

May have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1 (PubMed:24556617). May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons (PubMed:19011241).

Research Articles on NAT8B

Similar Products

Product Notes

The NAT8B nat8b (Catalog #AAA9133469) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAT8B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAT8B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the NAT8B nat8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WFLAKKPWTR YVDIALRTDM SDITKSYLSE CGSCFWVGES EEKVVGTVGA LPVDDPTLRE KRLQLFHLSV DNEHRGQGIA KALVRTVLQF A. It is sometimes possible for the material contained within the vial of "NAT8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.