Western Blot (WB)
(Western blot analysis of extracts of Jurkat cells, using GABRQ antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human GABRQ Polyclonal Antibody | anti-GABRQ antibody
GABRQ Polyclonal Antibody
Gene Names
GABRQ; THETA
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GABRQ; Polyclonal Antibody; GABRQ Polyclonal Antibody; THETA; anti-GABRQ antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
NYLFYSRGPRRQPRRHRRPRRVIARYRYQQVVVGNVQDGLINVEDGVSSLPITPAQAPLASPESLGSLTSTSEQAQLATSESLSPLTSLSGQAPLATGESLSDLPSTSEQARHSYGVRFNGFQADDSIIPTEIRNRVEAHGHGVTHDHEDSNESLSSDERHGHGPSGKPMLHHGEKGVQEAGWDLDDNNDKSDCLAIKEQFKCDTNSTWGLNDDELMAHGQEKDSSSESEDSCPPSPGCSFTEGFSFDLFN
Sequence Length
632
Applicable Applications for anti-GABRQ antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human GABRQ
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse
Positive Samples
Jurkat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Jurkat cells, using GABRQ antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of Jurkat cells, using GABRQ antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-GABRQ antibody
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes the theta subunit of the GABA A receptor. The gene is mapped to chromosome Xq28 in a cluster of genes including those that encode the alpha 3 and epsilon subunits of the GABA A receptor. This gene location is also the candidate region of two different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
Product Categories/Family for anti-GABRQ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 72kDa
Observed: 72kDa
Observed: 72kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit theta
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor theta subunit
NCBI Official Symbol
GABRQ
NCBI Official Synonym Symbols
THETA
NCBI Protein Information
gamma-aminobutyric acid receptor subunit theta
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit theta
Protein Family
UniProt Gene Name
GABRQ
NCBI Description
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes the theta subunit of the GABA A receptor. The gene is mapped to chromosome Xq28 in a cluster of genes including those that encode the alpha 3 and epsilon subunits of the GABA A receptor. [provided by RefSeq, Jul 2017]
Uniprot Description
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Research Articles on GABRQ
Similar Products
Product Notes
The GABRQ gabrq (Catalog #AAA9133274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRQ Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GABRQ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GABRQ gabrq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NYLFYSRGPR RQPRRHRRPR RVIARYRYQQ VVVGNVQDGL INVEDGVSSL PITPAQAPLA SPESLGSLTS TSEQAQLATS ESLSPLTSLS GQAPLATGES LSDLPSTSEQ ARHSYGVRFN GFQADDSIIP TEIRNRVEAH GHGVTHDHED SNESLSSDER HGHGPSGKPM LHHGEKGVQE AGWDLDDNND KSDCLAIKEQ FKCDTNSTWG LNDDELMAHG QEKDSSSESE DSCPPSPGCS FTEGFSFDLF N. It is sometimes possible for the material contained within the vial of "GABRQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
