Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FKBP14 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit FKBP14 Polyclonal Antibody | anti-FKBP14 antibody
FKBP14 Polyclonal Antibody
Gene Names
FKBP14; EDSKMH; FKBP22; IPBP12; EDSKSCL2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
FKBP14; Polyclonal Antibody; FKBP14 Polyclonal Antibody; EDSKMH; FKBP22; IPBP12; anti-FKBP14 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Sequence Length
211
Applicable Applications for anti-FKBP14 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human FKBP14
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum lumen
Positive Samples
H460, HeLa, U-87MG, MCF-7, Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FKBP14 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FKBP14 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-FKBP14 antibody
The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene.
Product Categories/Family for anti-FKBP14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 24kDa
Observed: 22kDa
Observed: 22kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP14
NCBI Official Synonym Full Names
FK506 binding protein 14
NCBI Official Symbol
FKBP14
NCBI Official Synonym Symbols
EDSKMH; FKBP22; IPBP12; EDSKSCL2
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP14
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP14
Protein Family
UniProt Gene Name
FKBP14
UniProt Synonym Gene Names
FKBP22; PPIase FKBP14; 22 kDa FKBP; FKBP-22; FKBP-14
NCBI Description
The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012]
Uniprot Description
PPIases accelerate the folding of proteins during protein synthesis.
Research Articles on FKBP14
Similar Products
Product Notes
The FKBP14 fkbp14 (Catalog #AAA9133269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP14 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the FKBP14 fkbp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALIPEPEVKI EVLQKPFICH RKTKGGDLML VHYEGYLEKD GSLFHSTHKH NNGQPIWFTL GILEALKGWD QGLKGMCVGE KRKLIIPPAL GYGKEGKGKI PPESTLIFNI DLLEIRNGPR SHESFQEMDL NDDWKLSKDE VKAYLKKEFE KHGAVVNESH HDALVEDIFD KEDEDKDGFI SAREFTYKHD EL. It is sometimes possible for the material contained within the vial of "FKBP14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
