Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34kD).)

Mouse anti-Human SCYL1 Monoclonal Antibody | anti-SCYL1 antibody

SCYL1 (SCY1-like Protein 1, N-terminal Kinase-like Protein, Coated Vesicle-associated Kinase of 90kD, CVAK90, GKLP, HT019, NKTL, NTKL, P105, Telomerase Regulation-associated Protein, TRAP, Telomerase Transcriptional Element-interacting Factor, TEIF, Terat

Gene Names
SCYL1; GKLP; NKTL; NTKL; P105; TAPK; TEIF; TRAP; HT019; SCAR21
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCYL1; Monoclonal Antibody; SCYL1 (SCY1-like Protein 1; N-terminal Kinase-like Protein; Coated Vesicle-associated Kinase of 90kD; CVAK90; GKLP; HT019; NKTL; NTKL; P105; Telomerase Regulation-associated Protein; TRAP; Telomerase Transcriptional Element-interacting Factor; TEIF; Terat; anti-SCYL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human SCYL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SCYL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa373-472 from human SCYL1 (AAH09967) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34kD).)

Western Blot (WB)

(SCYL1 monoclonal antibody. Western Blot analysis of SCYL1 expression in Hela NE.)

Western Blot (WB) (SCYL1 monoclonal antibody. Western Blot analysis of SCYL1 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged SCYL1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCYL1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SCYL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
86,371 Da
NCBI Official Full Name
Homo sapiens SCY1-like 1 (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
SCY1 like pseudokinase 1
NCBI Official Symbol
SCYL1
NCBI Official Synonym Symbols
GKLP; NKTL; NTKL; P105; TAPK; TEIF; TRAP; HT019; SCAR21
NCBI Protein Information
N-terminal kinase-like protein

NCBI Description

This gene encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-terminal domain. It activates transcription of the telomerase reverse transcriptase and DNA polymerase beta genes. The protein has been localized to the nucleus, and also to the cytoplasm and centrosomes during mitosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on SCYL1

Similar Products

Product Notes

The SCYL1 (Catalog #AAA6144248) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCYL1 (SCY1-like Protein 1, N-terminal Kinase-like Protein, Coated Vesicle-associated Kinase of 90kD, CVAK90, GKLP, HT019, NKTL, NTKL, P105, Telomerase Regulation-associated Protein, TRAP, Telomerase Transcriptional Element-interacting Factor, TEIF, Terat reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCYL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCYL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCYL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.