Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Mouse ARL6IP4 Polyclonal Antibody | anti-ARL6IP4 antibody

ARL6IP4 Polyclonal Antibody

Gene Names
ARL6IP4; SR-25; SRp25; SFRS20; SRrp37
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ARL6IP4; Polyclonal Antibody; ARL6IP4 Polyclonal Antibody; SFRS20; SR-25; SRp25; SRrp37; anti-ARL6IP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Sequence Length
413
Applicable Applications for anti-ARL6IP4 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human ARL6IP4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, Nucleus speckle, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-ARL6IP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa/28kDa/38kDa/42kDa/43kDa/44kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 6-interacting protein 4 isoform 3
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 6 interacting protein 4
NCBI Official Symbol
ARL6IP4
NCBI Official Synonym Symbols
SR-25; SRp25; SFRS20; SRrp37
NCBI Protein Information
ADP-ribosylation factor-like protein 6-interacting protein 4
UniProt Protein Name
ADP-ribosylation factor-like protein 6-interacting protein 4
UniProt Gene Name
ARL6IP4
UniProt Synonym Gene Names
ARL-6-interacting protein 4; Aip-4; SR-25

Uniprot Description

Involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site. In case of infection by Herpes simplex virus (HSVI), may act as a splicing inhibitor of HSVI pre-mRNA.

Similar Products

Product Notes

The ARL6IP4 arl6ip4 (Catalog #AAA9133141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL6IP4 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARL6IP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the ARL6IP4 arl6ip4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SAGEEEDGPV LTDEQKSRIQ AMKPMTKEEW DARQSIIRKV VDPETGRTRL IKGDGEVLEE IVTKERHREI NKQATRGDCL AFQMRAGLLP. It is sometimes possible for the material contained within the vial of "ARL6IP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.