Zinc finger protein GLI1 (GLI1) Recombinant Protein | GLI1 recombinant protein

Recombinant Human Zinc finger protein GLI1 (GLI1), partial

Cat. Num. AAA9018490

• Gene Names: GLI1; GLI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein GLI1 (GLI1); Recombinant Human Zinc finger protein GLI1 (GLI1); partial; Zinc finger protein GLI1(Glioma-associated oncogene)(Oncogene GLI); GLI1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 201-400aa, Partial
• Sequence: SPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGD

• Species: Homo sapiens (Human)
• Relevance: Acts as a transcriptional activator (PubMed:19706761, PubMed:10806483, PubMed:19878745, PubMed:24311597, PubMed:24217340). Binds to the DNA consensus sequence 5'-GACCACCCA-3' (PubMed:2105456, PubMed:8378770, PubMed:24217340). Regulates the transcription of specific genes during normal development (PubMed:19706761). Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling (PubMed:19706761, PubMed:28973407). Plays a role in cell proliferation and differentiation via its role in SHH signaling (PubMed:11238441, PubMed:28973407).; [Isoform 2]: Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for GLI1 recombinant protein

Developmental Biology

References

Polymorphic variants of the human oncogene GLI1 function similarly.Yoon J.W., Kent P., Clark A., Patterson J., Villavicencio E., Iannaccone P., Walterhouse D.A novel splice variant of GLI1 that promotes glioblastoma cell migration and invasion.Lo H.W., Zhu H., Cao X., Aldrich A., Ali-Osman F.Cancer Res. 69:6790-6798(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 121323
• NCBI GeneID: 2735
• UniProt Accession #: P08151; Q8TDN9; D0EUY3; E9PQQ9; F5H6H8
• Molecular Weight: 104,627 Da
• NCBI Official Full Name: Zinc finger protein GLI1
• NCBI Official Synonym Full Names: GLI family zinc finger 1
• NCBI Official Symbol: GLI1
• NCBI Official Synonym Symbols: GLI
• NCBI Protein Information: zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; GLI-Kruppel family member GLI1; glioma-associated oncogene homolog 1 (zinc finger protein)
• UniProt Protein Name: Zinc finger protein GLI1
• Protein Family: Zinc finger protein
• UniProt Gene Name: GLI1
• UniProt Synonym Gene Names: GLI
• UniProt Entry Name: GLI1_HUMAN

NCBI Description

This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

GLI1: Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation. Interacts with KIF7. Interacts with ZIC1; the interaction enhances transcription activation. Amplified in glioblastoma cells. Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. Belongs to the GLI C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Oncoprotein; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 12q13.2-q13.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nucleus; cytosol

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; DNA binding; metal ion binding; microtubule binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; smoothened signaling pathway; ventral midline development; smoothened signaling pathway in regulation of granule cell precursor cell proliferation; positive regulation of transcription, DNA-dependent; digestive tract morphogenesis; notochord regression; osteoblast differentiation; cerebellar cortex morphogenesis; dorsal/ventral pattern formation; pituitary gland development; positive regulation of cell proliferation; positive regulation of smoothened signaling pathway; epidermal cell differentiation; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of DNA replication; proximal/distal pattern formation; regulation of smoothened signaling pathway; lung development