Aminopeptidase N (ANPEP) Recombinant Protein | ANPEP recombinant protein

Recombinant Human Aminopeptidase N (ANPEP), partial

Cat. Num. AAA9018461

• Gene Names: ANPEP; APN; CD13; LAP1; P150; PEPN; GP150
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Aminopeptidase N (ANPEP); Recombinant Human Aminopeptidase N (ANPEP); partial; AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD13; ANPEP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 34-219aa, Partial
• Sequence: SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK

• Species: Homo sapiens (Human)
• Relevance: Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization. May have a role in amino acid transport by acting as binding partner of amino acid transporter SLC6A19 and regulating its activity.(Microbial infection) Acts as a receptor for human coronavirus 229E/HCoV-229E. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein(Microbial infection) Mediates as well Human cytomegalovirus (HCMV) infection.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for ANPEP recombinant protein

Immunology

References

"Soluble aminopeptidase N/CD13 in malignant and nonmalignant effusions and intratumoral fluid."van Hensbergen Y., Broxterman H.J., Hanemaaijer R., Jorna A.S., van Lent N.A., Verheul H.M., Pinedo H.M., Hoekman K.Clin. Cancer Res. 8:3747-3754(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 157266300
• NCBI GeneID: 290
• NCBI Accession #: NP_001141.2
• NCBI GenBank Nucleotide #: NM_001150.2
• UniProt Accession #: P15144; Q16728; Q6GT90; Q8IUK3; Q8IVH3; Q9UCE0
• Molecular Weight: 109,540 Da
• NCBI Official Full Name: aminopeptidase N
• NCBI Official Synonym Full Names: alanyl (membrane) aminopeptidase
• NCBI Official Symbol: ANPEP
• NCBI Official Synonym Symbols: APN; CD13; LAP1; P150; PEPN; GP150
• NCBI Protein Information: aminopeptidase N; AP-M; AP-N; hAPN; aminopeptidase M; alanyl aminopeptidase; microsomal aminopeptidase; myeloid plasma membrane glycoprotein CD13
• UniProt Protein Name: Aminopeptidase N
• Protein Family: Aminopeptidase
• UniProt Gene Name: ANPEP
• UniProt Synonym Gene Names: APN; CD13; PEPN; AP-N; hAPN; AP-M
• UniProt Entry Name: AMPN_HUMAN

NCBI Description

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq, Jul 2008]

Uniprot Description

CD13: Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types including small intestinal and tubular epithelial cells, macrophages, granulocytes and synaptic membranes from the CNS. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection. Belongs to the peptidase M1 family.

Protein type: Receptor, misc.; EC 3.4.11.2; Other Amino Acids Metabolism - glutathione; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 15q25-q26

Cellular Component: extracellular space; lysosomal membrane; integral to plasma membrane; ER-Golgi intermediate compartment; cytosol; external side of plasma membrane

Molecular Function: viral receptor activity; zinc ion binding; metallopeptidase activity; receptor activity; aminopeptidase activity

Biological Process: entry of virus into host cell; cellular protein metabolic process; angiogenesis; angiotensin maturation; cell differentiation; proteolysis