Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

INS, 25-110 aa, His-tag Active Protein | INS active protein

INS, 25-110 aa, His-tag, Human Recombinant

Purity
>= 95% by SDS-PAGE
Synonyms
INS; 25-110 aa; His-tag; Human Recombinant; Insulin preproprotein; IDDM; IDDM1; IDDM2; ILPR; IRDN; MODY10; INS active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>= 95% by SDS-PAGE
Form/Format
Liquid. In Phosphate-Buffered Saline (pH7.4) containing 10% Glycerol
Concentration
0.5mg/ml (determined by Absorbance at 280nm) (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSHMGSFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Gene Source
Human
Endotoxin
<1.0 EU per 1ug of protein (determined by LAL method)
Biological Activity
Measured in a cell proliferation assay using MCF7 human breast cancer cells. The ED50 for this effect is less or equal to 4 ug/ml.
Preparation and Storage
Store at -20 degree C
Centrifuge the vial prior to opening.
Shelf life: ~12 months

SDS-Page

SDS-Page
Related Product Information for INS active protein
INS, also known as insulin preproprotein, is a biologically inactive precursor to the biologically active endocrine hormone insulin. Insulin is an essential hormone for maintaining metabolic homeostasis in the body. To make fully bioactive insulin, pancreatic beta cells initiate synthesis of INS. It is converted into proinsulin by signal peptidases, which remove its signal peptide from its N-terminus. Finally, proinsulin is converted into the bioactive hormone insulin by removal of the C-peptide. Recombinant human INS, fused to His-tag at N-terminus, was expressed in E Coli and purified by conventional chromatography techniques.
Product Categories/Family for INS active protein

NCBI and Uniprot Product Information

NCBI GeneID
Molecular Weight
11.8kDa (109 aa), confirmed by MALDI-TOF
Protein Family

Similar Products

Product Notes

The INS (Catalog #AAA849926) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MGSFVNQHLC GSHLVEALYL VCGERGFFYT PKTRREAEDL QVGQVELGGG PGAGSLQPLA LEGSLQKRGI VEQCCTSICS LYQLENYCN. It is sometimes possible for the material contained within the vial of "INS, 25-110 aa, His-tag, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.