Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Alpha-2-HS-glycoprotein Recombinant Protein

Recombinant human Alpha-2-HS-glycoprotein

Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-2-HS-glycoprotein; Recombinant human Alpha-2-HS-glycoprotein; Alpha-2-Z-globulin; Alpha-2-HS-glycoprotein recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
PHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPD
Applicable Applications for Alpha-2-HS-glycoprotein recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Alpha-2-HS-glycoprotein recombinant protein
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
35 kd
NCBI Official Full Name
alpha-2-HS-glycoprotein
Protein Family

Uniprot Description

FETUA: Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. Alpha-2-HS glycoprotein derives from this precursor, when the connecting peptide is cleaved off. The two chains A and B are held together by a single disulfide bond. Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins. Belongs to the fetuin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space; extracellular region

Molecular Function: kinase inhibitor activity; cysteine protease inhibitor activity

Biological Process: negative regulation of bone mineralization; pinocytosis; ossification; positive regulation of phagocytosis; regulation of inflammatory response; acute-phase response; negative regulation of insulin receptor signaling pathway; negative regulation of phosphorylation; regulation of bone mineralization; skeletal development

Similar Products

Product Notes

The Alpha-2-HS-glycoprotein (Catalog #AAA719389) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Alpha-2-HS-glycoprotein can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the Alpha-2-HS-glycoprotein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PHGPGLIYRQ PNCDDPETEE AALVAIDYIN QNLPWGYKHT LNQIDEVKVW PQQPSGELFE IEIDTLETTC HVLDPTPVAR CSVRQLKEHA VEGDCDFQLL KLDGKFSVVY AKCDSSPDSA EDVRKVCQDC PLLAPLNDTR VVHAAKAALA AFNAQNNGSN FQLEEISRAQ LVPLPPSTYV EFTVSGTDCV AKEATEAAKC NLLAEKQYGF CKATLSEKLG GAEVAVTCMV FQTQPVSSQP QPEGANEAVP TPVVDPDAPP SPPLGAPGLP PAGSPPD. It is sometimes possible for the material contained within the vial of "Alpha-2-HS-glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.